KEGG   Ursus arctos horribilis: 113250654
Entry
113250654         CDS       T05909                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05212  Pancreatic cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113250654 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113250654 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113250654 (STAT1)
   04621 NOD-like receptor signaling pathway
    113250654 (STAT1)
   04625 C-type lectin receptor signaling pathway
    113250654 (STAT1)
   04658 Th1 and Th2 cell differentiation
    113250654 (STAT1)
   04659 Th17 cell differentiation
    113250654 (STAT1)
   04062 Chemokine signaling pathway
    113250654 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113250654 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    113250654 (STAT1)
   04919 Thyroid hormone signaling pathway
    113250654 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113250654 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113250654 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113250654 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113250654 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113250654 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113250654 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113250654 (STAT1)
  09172 Infectious disease: viral
   05162 Measles
    113250654 (STAT1)
   05164 Influenza A
    113250654 (STAT1)
   05161 Hepatitis B
    113250654 (STAT1)
   05160 Hepatitis C
    113250654 (STAT1)
   05168 Herpes simplex virus 1 infection
    113250654 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113250654 (STAT1)
   05169 Epstein-Barr virus infection
    113250654 (STAT1)
   05165 Human papillomavirus infection
    113250654 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113250654 (STAT1)
   05140 Leishmaniasis
    113250654 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113250654 (STAT1)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113250654 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 BLI1 DUF1633
Other DBs
NCBI-GeneID: 113250654
NCBI-ProteinID: XP_026348094
UniProt: A0A3Q7W005
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHEANGVAKNDQKQEQMLIQKMYLMLDNKRKEVVHKIIELLNVTELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagctccaacagcttgactccaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtacctggcacagtggctagaaaaa
caagactgggagcatgctgctaatgacgtttcatttgccaccatccgatttcatgacctc
ctgtcacagctggatgatcagtatagtcgcttttctttggagaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaggaaaggaagatcctggaaaatgcccag
agattcaatcaggcgcagtcggggaacattcagagcacggtgatgttagacaaacagaag
gagctcgacagcaaagtcagaaatgtgaaagataaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaagatgaatatgactttaagtgcaaaaccttgcagaacaga
gagcatgaagccaatggcgtggcaaagaatgatcagaaacaagagcagatgttaatccag
aagatgtatttaatgctcgacaataaaagaaaggaagtagttcacaaaataatagagttg
ttgaatgtcacggaacttacccagaaagccctgattaatgatgagctggtggaatggaag
cagagacagcagagtgcctgtattggggggccccccaacgcttgtcttgatcagctgcag
aactggttcaccatcgttgcggagagtctgcagcaggttcgtcagcagcttaaaaagctc
gaggaattggaacagaagtacacctacgaacacgacccaatcacaaaaaacaaacaaggg
ctgtgggaccgcaccttcagccttttccagcagctcatccagagctcctttgtggtggaa
agacagccttgcatgccaactcatcctcagaggccactggtcttgaagaccggggtccag
ttcactgtgaagttgagactgctggtgaaattgcaagagctcaattacaatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttagaaagttc
aacattttgggcacacatacgaaagtgatgaacatggaggagtccaccaatggaagtctg
gcagcagaattccgacacctgcaactgaaagagcagaaaaatgccggcaccagaactaac
gagggccctcttatcgttactgaagagcttcactcccttagttttgagacccagttgtgc
cagcctggtttggtcattgacctcgagactacctctctgcccgttgtggtgatctccaac
gtcagccagctcccgagtggttgggcctccatcctctggtacaacatgctggtgacagaa
ccccggaacctgtccttcttcctgaacccaccctgtgcacgatggtcccagctctcggag
gtgctcagctggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctcaac
atgctaggagagaaactactcggtcctaatgctggccccgatggtctcattccgtggaca
aggttctgcaaggaaaatataaatgataaaaattttcctttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctctctctggaatgatgggtgcatcgtgggc
tttatcagcaaggagcgagagcgcgcgctgctcaaggaccagcagccgggcacgttcctg
ctgcgcttcagcgagagctgccgggaaggggccatcacgttcacgtgggtggagcggccg
cagaacggaggcgaaccttacttccatgccgtcgagccctacacgaagaaagaactttct
gctgttactttccctgatattattcgcaattacaaagtcatggctgctgaaaatattcca
gagaatcccctgaagtatctgtatccgaatattgataaagaccatgcctttgggaaatat
tactccaggccaaaggaagccccagaaccaatggaactcgatggccctaaaggaactgga
tacatcaagactgagttgatttctgtgtctgaagttcacccctctcgacttcagaccaca
gacaaccttctccccatgtcccctgaggagtttgacgaggtgtctcggatagtgggttcc
gtagagttcgacagtatgatgaatgcagtatag

KEGG   Ursus arctos horribilis: 113256419
Entry
113256419         CDS       T05909                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256419 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113256419 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113256419 (STAT2)
   04625 C-type lectin receptor signaling pathway
    113256419 (STAT2)
   04062 Chemokine signaling pathway
    113256419 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113256419 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256419 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    113256419 (STAT2)
   05164 Influenza A
    113256419 (STAT2)
   05161 Hepatitis B
    113256419 (STAT2)
   05160 Hepatitis C
    113256419 (STAT2)
   05168 Herpes simplex virus 1 infection
    113256419 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113256419 (STAT2)
   05169 Epstein-Barr virus infection
    113256419 (STAT2)
   05165 Human papillomavirus infection
    113256419 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113256419 (STAT2)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113256419 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 113256419
NCBI-ProteinID: XP_026356044
UniProt: A0A3Q7WPB4
LinkDB
Position
Unknown
AA seq 854 aa
MAQWEMLQNLSSPFQDRLHQLYSDSLLPMDIRQCLAVWIEDQNWQEAALGNDDSKATVLF
FHFLDQLNNECGRCSQDPDLLLLQHNLRKFSRDIQAFPQGPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPALEAPVESQQHEIESRILELKTMMEMLVKSISQLKDQQDVFCFRYKTQ
AQVKTLSLDPHQTRQRQLLQETLNELDRRRKEVLDATKALLGQLTTLVELLLPKLEEWKV
QQQKACVGAPLDAGLEQLEKWFTAGARLLFHLRQLLKELEGLSRLVSYKDDPLTTGVDLR
KAQVTELLQHLLQRAFVVETQPCMPQIPHRPLILKTGSKFIVQARLLVRLQEGNESLTAE
VSIDRNPPQSQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGCNKG
MLGVTEELHVISITVNYTYQGLKQELRTDTLPVVIISNMSQVSIAWASVLWFNLLSSNPQ
NQQFFSSPPKAPWSLLGPALSWQFSSYVGRGLDPDQLSMLRNKLFGQNSRTEGASLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERKLLKKTISGTFLL
RFSETSEGGITCSWVEHQDDDRVLIYSVQPFTKEVLQSLPLTKIIRHYQLLTDENIPENP
LCFLYPRIPRDEAFGHYYQEKVNLEERRKYLKHKLIVVSNRQVDELQQPPDLKLEPEAES
FELESGLAPLLQLEPGLELEPLLEAGLNLGPALEPLLEPALDVAQRVSEPDLGPELKLEP
ILDPASQAVPEPDLPHDLRHLNTEEMEIFRNSMKIEEIMPNGDPLFAGQNTVDEAYAFHP
SHFCTDGPLIPSDY
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaatctcagcagcccatttcaggaccggctgcaccag
ctgtactcagatagcctcctgccaatggacattcgacagtgcttagctgtctggattgaa
gaccagaactggcaggaggctgcactgggcaatgatgattccaaggctaccgtgctgttc
ttccacttcttggaccaactgaacaacgagtgtggccgctgcagccaggaccccgatctc
ttgttactacagcacaacttgcgaaaattctctcgggacattcaggcctttccccagggc
cctacccaattggctgagatgatctttaatctccttctggaagaaaaaagaattctgatc
caggcccagagggctcagttggagcaaggagagccagccctcgaagcacccgtagagagc
cagcagcatgagattgagtcccggatactggaattaaagactatgatggagatgctggtg
aaatccatctcccagctgaaagaccagcaggatgtcttctgcttccggtataagacccag
gcccaagtgaagacactctctttagacccccatcagacgagacagcggcagctgctgcag
gagactctcaatgaactggacagaaggagaaaggaggtgctggacgccaccaaagccttg
ctaggccaattaacaaccctcgttgagctactgctgcccaagttggaggaatggaaagtc
cagcagcagaaagcctgcgttggagcccctctggatgcagggttggaacagctggagaag
tggttcacagccggagccaggctgctgtttcacctgcgtcagctgttgaaggagctggag
ggactgagtcgcctggttagctataaggatgaccctctgaccaccggggtggacctgcgg
aaggcccaggtcacggagttgctacagcacctgctccagagggcctttgtggtagaaacc
cagccctgcatgccccaaattccccatcgacccctcatcctcaagactgggagcaagttc
attgtccaagcaaggctgctcgtgagactccaggaaggcaatgagtcactaacggcagaa
gtctccattgacaggaatcctcctcagtcacaaggcttccggaagttcaacattctaacc
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggcttaatttgggacttc
ggctatctgactctagtggagcaacgttcaggtggctcaggaaagggctgcaataaggga
atgctgggcgtgacagaggagctgcacgtcatcagcattacggtcaactacacctaccag
ggtctgaagcaggagctgagaacggacaccctccctgtggtgattatatctaacatgagc
caagtctccattgcctgggcctcggttctttggttcaatctgcttagctcaaacccccag
aatcagcagttcttctccagcccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctacgttggccgaggccttgacccagaccagctgagcatgctg
aggaacaagctgtttgggcagaactctaggactgagggtgcatcgttatcctgggctgac
ttcactaagcgagagagccctcctggcaagctaccattctggacatggttagacaaaatt
ctggagctggtgcatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagccggagccaggagcgcaagctgctgaagaagaccatctccggcaccttcctgctg
cgcttcagcgagacgtcggagggaggcattacctgctcctgggtggaacaccaggacgat
gatagggtgctcatctactctgtgcagcccttcaccaaggaagtgctgcagtctctcccg
ctgaccaaaatcattcgccactaccagctgctcacggacgagaacatccccgagaaccca
ctgtgcttcctctacccccggataccccgggatgaggctttcgggcactactaccaggag
aaagttaacctcgaggaacggaggaagtacctgaaacataagctcattgtggtctctaac
agacaggttgatgagctgcagcaaccaccggaccttaagctggagccagaagcggagtcg
tttgagctggagtcaggactggccccactgctacagctagagccaggcctggagttggag
ccactgctggaggcaggactgaatctggggccagccctggagcccctgctggagcccgca
ctggatgtggcacaaagagtgtcagagccagacttgggaccagagctgaagctggagcct
attctagaccccgcatcacaggcagtgccagagccagatttgccccatgatctgagacac
ttgaacaccgaggaaatggaaatcttcagaaacagtatgaagattgaagaaatcatgcca
aatggtgacccactgtttgctggacagaacaccgtggacgaggcttacgctttccatccc
agccatttctgcacggacgggcccttgattccttctgactactag

DBGET integrated database retrieval system