KEGG   Ursus arctos horribilis: 113251173
Entry
113251173         CDS       T05909                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113251173 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113251173 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113251173 (IL17D)
   04659 Th17 cell differentiation
    113251173 (IL17D)
   04657 IL-17 signaling pathway
    113251173 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113251173 (IL17D)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113251173 (IL17D)
SSDB
Motif
Pfam: IL17 Phage_holin_7_1
Other DBs
NCBI-GeneID: 113251173
NCBI-ProteinID: XP_026348757
UniProt: A0A3Q7WEI8
LinkDB
Position
Unknown
AA seq 209 aa
MARAGVWMLVVGVLLALAPGRAAGALRASRRPARPRGCADRPEELLEQLYGRLAAGVLGA
FHHTLQLGPREQARNASCPAGGRPGDRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAY
CLCRGCLTGLFGEEDLRFRSAPVYMPTVILRRTSACAGGRSVYVEEYVTVPVGCTCVPEP
EKEADSPNSSMDKPGAKLLLSPGDKPGRP
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcgtgcgggggtctggatgctggtggtcggcgtcctgctggcgttggcgccgggc
cgggccgcaggcgccctgagggcgagcagacgcccggcgcggccgcggggctgcgccgac
cggcccgaggagctcctggagcagctgtacgggcggctggcggcgggcgtgctcggcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgtaacgcgagctgcccggca
gggggcaggcccggcgaccggcgcttccggccgcccaccaacctgcgcagcgtgtcgccg
tgggcctacagaatttcctacgaccccgccaggtacccgaagtacctgcccgaggcctac
tgcctgtgcagaggctgcctgaccgggctgttcggggaggaggatctgcgtttccggagc
gccccggtgtacatgcccaccgtcatcctgcggcggacgtcggcctgcgcgggcggccgc
tcggtgtacgtggaggagtacgtcaccgtgccggtgggctgcacctgcgtccccgagccc
gagaaggaggcggacagccccaactccagcatggacaagccgggcgccaagctcctgctc
agccccggcgacaagccgggccggccctga

DBGET integrated database retrieval system