KEGG   Ursus arctos horribilis: 113251743
Entry
113251743         CDS       T05909                                 

Gene name
MAF
Definition
(RefSeq) transcription factor Maf
  KO
K09035  transcription factor Maf
Organism
uah  Ursus arctos horribilis
Pathway
uah04658  Th1 and Th2 cell differentiation
uah05202  Transcriptional misregulation in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113251743 (MAF)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113251743 (MAF)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113251743 (MAF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113251743 (MAF)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    113251743 (MAF)
SSDB
Motif
Pfam: bZIP_Maf Maf_N ZapB bZIP_1 bZIP_2 KASH_CCD GAS APC_N_CC vATP-synt_E NUDE_C
Other DBs
NCBI-GeneID: 113251743
NCBI-ProteinID: XP_026349501
UniProt: A0A3Q7ULV4
LinkDB
Position
Unknown
AA seq 386 aa
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLASAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHHAAGHHHHPTAGAPGAASSASASAAHHAAGGLHFDDRFSDEQLVTMSVRELNR
QLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISR
LVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLKPSVGYARFWKPRPCV
LTVYSQKEIYVPKGILCISDVKNPVA
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccttgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctgaacccggaggcgctgggcttcagccccgaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggcggcttcgatggctacgcgcgcggagcgcagcagctggcctcg
gcggccggggccggcgccggcgcctccctgggcggcagcggcgaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgccgcgcagagcggcgcgggcccgcac
taccaccaccaccaccaccaccacgccgccggccaccaccaccacccgacggccggcgcg
ccgggcgcggcgtccagcgcgtccgcctcggccgcgcaccacgccgccggcggcctgcac
ttcgacgaccgcttctccgacgagcagctggtgaccatgtcggtgcgcgagctgaaccgg
cagctgcgcggggtcagcaaggaggaggtgatccggctgaagcagaagaggcggaccctg
aaaaaccgtggctatgcccagtcctgccgcttcaagagggtgcagcagagacacgtcctg
gagtccgagaagaaccagctgctgcagcaggtcgaccacctcaagcaggagatctccagg
ctggtgcgcgagagggacgcgtacaaggagaaatacgagaagttggtgagcagcggcttc
cgagaaaacggctccagcagcgacaacccgtcctctcccgagtttttcataactgagccc
actcgcaagttgaagccatcagtgggatacgccagattttggaagccccggccatgtgta
cttacagtgtattcacaaaaagaaatttatgtacccaagggaatcctctgcatcagtgat
gtgaaaaaccctgttgcctga

DBGET integrated database retrieval system