KEGG   Ursus arctos horribilis: 113251904
Entry
113251904         CDS       T05909                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
uah  Ursus arctos horribilis
Pathway
uah00480  Glutathione metabolism
uah00980  Metabolism of xenobiotics by cytochrome P450
uah00982  Drug metabolism - cytochrome P450
uah00983  Drug metabolism - other enzymes
uah01100  Metabolic pathways
uah01524  Platinum drug resistance
uah05200  Pathways in cancer
uah05204  Chemical carcinogenesis
uah05225  Hepatocellular carcinoma
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113251904 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113251904 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    113251904 (GSTO1)
   00983 Drug metabolism - other enzymes
    113251904 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113251904 (GSTO1)
   05204 Chemical carcinogenesis
    113251904 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113251904 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113251904 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113251904 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:uah02000]
    113251904 (GSTO1)
Enzymes [BR:uah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113251904 (GSTO1)
Transporters [BR:uah02000]
 Other transporters
  Pores ion channels [TC:1]
   113251904 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 113251904
NCBI-ProteinID: XP_026349850
UniProt: A0A3Q7UMT4
LinkDB
Position
Unknown
AA seq 241 aa
MSGGSARSLAKGSAPPGQVPEGLIRVYSMRFCPFAQRTRLVLKAKGIRHEIININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKAYQKMVFELF
SKIPSLVASFLRRQNEEDCSGLKEELRKEFSKLEEVLTNKKTTFFGGNSVSMIDYLIWPW
FERLEVLELNDCADHTLKLKLWMAAMREDPAVSALLTEPKVFRGFLSLYLQNSPDACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggagggtcggccaggagcctagcgaagggaagcgcgcccccgggacaggtcccc
gagggcctgatccgcgtctacagcatgaggttctgcccgttcgcgcagaggacacgcctg
gtcctgaaggccaagggaatcaggcatgaaatcatcaacatcaacctgaaaaataagcct
gagtggttctttaagaagaatccctttggcctggtgccagttctggaaaacagtcagggt
caactgatctacgaatctgccatcacttgtgagtacctggatgaagcctatcccgggaag
aagctgttgccagacgacccctatgagaaagcttaccaaaagatggtgttcgagttattt
tcgaagattccatctttggtagcaagctttctgagaagacaaaatgaggaagactgctct
ggcctaaaagaagaattgcggaaagaattcagcaagcttgaggaggttcttaccaataag
aagacaaccttctttggtggcaattctgtttctatgattgattacctcatctggccctgg
tttgaacggctggaagttctggagttaaatgattgtgcagaccacactcttaaacttaag
ctctggatggcagccatgagggaagatcctgcagtgtcagccctcctcactgagcccaag
gtctttcgaggtttcctcagtctctatttgcagaacagccccgacgcctgtgactatggg
ctctga

DBGET integrated database retrieval system