KEGG   Ursus arctos horribilis: 113251972
Entry
113251972         CDS       T05909                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04012  ErbB signaling pathway
uah04062  Chemokine signaling pathway
uah04110  Cell cycle
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04310  Wnt signaling pathway
uah04340  Hedgehog signaling pathway
uah04360  Axon guidance
uah04390  Hippo signaling pathway
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04657  IL-17 signaling pathway
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04722  Neurotrophin signaling pathway
uah04728  Dopaminergic synapse
uah04910  Insulin signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05135  Yersinia infection
uah05160  Hepatitis C
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05213  Endometrial cancer
uah05215  Prostate cancer
uah05217  Basal cell carcinoma
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113251972 (GSK3B)
   04310 Wnt signaling pathway
    113251972 (GSK3B)
   04340 Hedgehog signaling pathway
    113251972 (GSK3B)
   04390 Hippo signaling pathway
    113251972 (GSK3B)
   04151 PI3K-Akt signaling pathway
    113251972 (GSK3B)
   04150 mTOR signaling pathway
    113251972 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113251972 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113251972 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    113251972 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    113251972 (GSK3B)
   04657 IL-17 signaling pathway
    113251972 (GSK3B)
   04662 B cell receptor signaling pathway
    113251972 (GSK3B)
   04062 Chemokine signaling pathway
    113251972 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113251972 (GSK3B)
   04917 Prolactin signaling pathway
    113251972 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    113251972 (GSK3B)
   04919 Thyroid hormone signaling pathway
    113251972 (GSK3B)
   04916 Melanogenesis
    113251972 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    113251972 (GSK3B)
   04722 Neurotrophin signaling pathway
    113251972 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    113251972 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113251972 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113251972 (GSK3B)
   05225 Hepatocellular carcinoma
    113251972 (GSK3B)
   05226 Gastric cancer
    113251972 (GSK3B)
   05217 Basal cell carcinoma
    113251972 (GSK3B)
   05215 Prostate cancer
    113251972 (GSK3B)
   05213 Endometrial cancer
    113251972 (GSK3B)
   05224 Breast cancer
    113251972 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113251972 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113251972 (GSK3B)
   04931 Insulin resistance
    113251972 (GSK3B)
   04934 Cushing syndrome
    113251972 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113251972 (GSK3B)
  09172 Infectious disease: viral
   05162 Measles
    113251972 (GSK3B)
   05160 Hepatitis C
    113251972 (GSK3B)
   05163 Human cytomegalovirus infection
    113251972 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113251972 (GSK3B)
   05165 Human papillomavirus infection
    113251972 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113251972 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113251972 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:uah03036]
    113251972 (GSK3B)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     113251972 (GSK3B)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   113251972 (GSK3B)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113251972 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 113251972
NCBI-ProteinID: XP_026350005
UniProt: A0A3Q7VCW8
LinkDB
Position
Unknown
AA seq 436 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASGPLRCLTWW
QLVFPGPTDPRKRTRC
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccaccgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctccagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaaccccaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggacgccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattaagggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagggccacttaggtgtctcacatggtgg
cagctggttttccctggaccaactgatccaagaaagaggacaagatgctaa

DBGET integrated database retrieval system