KEGG   Ursus arctos horribilis: 113252170
Entry
113252170         CDS       T05909                                 

Gene name
CD86
Definition
(RefSeq) T-lymphocyte activation antigen CD86 isoform X1
  KO
K05413  CD86 antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04514  Cell adhesion molecules (CAMs)
uah04620  Toll-like receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05202  Transcriptional misregulation in cancer
uah05320  Autoimmune thyroid disease
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113252170 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113252170 (CD86)
   04672 Intestinal immune network for IgA production
    113252170 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113252170 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    113252170 (CD86)
   05323 Rheumatoid arthritis
    113252170 (CD86)
   05320 Autoimmune thyroid disease
    113252170 (CD86)
   05330 Allograft rejection
    113252170 (CD86)
   05332 Graft-versus-host disease
    113252170 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113252170 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113252170 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113252170 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113252170 (CD86)
   04090 CD molecules [BR:uah04090]
    113252170 (CD86)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113252170 (CD86)
CD molecules [BR:uah04090]
 Proteins
  113252170 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 I-set C2-set_2 ig Phage_holin_3_6 DUF4381 WBP-1 TMEM52 EphA2_TM
Other DBs
NCBI-GeneID: 113252170
NCBI-ProteinID: XP_026350430
UniProt: A0A3Q7VE63
LinkDB
Position
Unknown
AA seq 343 aa
MGICDSTMGLSNILLGMALLISGAASMTSQGYFNKTGELPCHFTNSQNISLDELVVFWQD
QDKLVLYELYRGKENPQNVHPKYKGRTSFDKDNWTLKLHNIQIKDMGSYQCFIHHKGPKG
LVPMYHMGSELSVLANFTQPEIMVTSNRTENSGIINLTCSSVQGYPEPKEMYFKLKTENS
TTKYDTAMKKSQNNVTELYNISISLSFSVPEASNVSITCVLQLESMELHSLPYNIDAHTK
PPPAQDPILWIAALLVMLVILCGMVLVCFLTLRKRKKKQPGPSHECETNKMERKESEQAM
ERLQPHVPEKADEAQCVNISKTTSGDKKHTCGPSSPDTLLARD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggcatttgtgacagcactatgggactgagtaacattctccttgggatggccctcctg
atctctggtgctgcttccatgacgagtcaagggtatttcaacaagactggagaactgccg
tgccattttacaaactctcaaaacataagcctggatgagttggtagtattttggcaggac
caggataagctggttctgtatgagctataccgaggcaaagagaaccctcaaaatgtccat
cccaagtataaaggccgcacaagctttgacaaggacaactggaccctgaaactccacaac
attcagatcaaggacatgggctcatatcaatgtttcattcaccataaagggcccaaagga
ctagttcccatgtaccacatgggttcagagctatcagtgcttgctaacttcactcaacct
gaaataatggtaacttctaatagaacagaaaattctggcatcataaatttgacctgctca
tctgtacaaggttacccagaacctaaggagatgtattttaagctaaaaaccgagaattca
actactaagtatgatactgccatgaagaaatctcaaaataatgtcacagaactgtacaac
atttctatcagcttgtctttttcagtccctgaagcaagcaatgtgagcatcacctgtgtc
ctgcaacttgagtcaatggaacttcactccctaccgtacaatatagatgcacatacgaaa
cccccccctgcccaagaccccatcctctggattgcggctctacttgtaatgttggtcatt
ttgtgtgggatggtgttggtgtgctttctaacactaaggaaaaggaagaagaagcagcct
ggcccctctcatgaatgtgaaaccaacaaaatggagagaaaagagagtgaacaggccatg
gaaagactacaaccccatgtacctgaaaaagctgatgaagcccagtgtgttaacatttcg
aagacaacctcgggcgacaaaaagcacacttgtgggccgagctcacctgacacgctcctg
gctcgggactaa

DBGET integrated database retrieval system