KEGG   Ursus arctos horribilis: 113252283
Entry
113252283         CDS       T05909                                 

Gene name
CX3CL1
Definition
(RefSeq) fractalkine
  KO
K05508  C-X3-C motif chemokine 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04668  TNF signaling pathway
uah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113252283 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113252283 (CX3CL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113252283 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113252283 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113252283 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113252283 (CX3CL1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113252283 (CX3CL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113252283
NCBI-ProteinID: XP_026350622
UniProt: A0A3Q7WJI3
LinkDB
Position
Unknown
AA seq 432 aa
MAPPPLSWLLRVAALCHLTMLLAGQHLGVKKCNVTCSRMTSEIPVALLAHYQRNQESCGK
PAIILRTKKNRTFCADPKEQWVQKAIEHLKNKTAVQTQNGGTFEMLIGGGDPRTTPATRG
TDRPAVTEPKSTQGNSGPEAQRTLETSPELPTGVADSWGTGFPSTPKAPDGGAPAGSQKT
EFFNAAALTTATSWQSSAAYDPWSGLWTAGKASEALPTQASPTQAPSTQAPSTQTPSTQT
PSTQAPPTQAPSTQTLSTQAPPTHTPTISHTASEKSVGPEGQPMWVTGDDLTPENSLGPE
ETGPVSAHTDAFGGPEGTPRLSTVPVSSQRVPSREPAASGSWSSKSEEPIHATVDPQRLG
VLITPVPDSHAATRRQAVGLLAFLGLLFCLGVAMFAYQSLQGCPRKLAGDMVEGLRYVPR
SCGSNSYVLVPV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctcctccacccctctcgtggctgctccgcgtggctgccctctgccatctgaccatg
ctgctggccggacagcacctcggtgtgaagaagtgcaacgtcacgtgcagcaggatgacc
tcggagatccccgtggccttactagcccactaccagcgaaatcaagagtcctgcgggaag
cctgccatcatcttgagaacaaaaaagaacagaaccttctgtgctgatccaaaggagcaa
tgggttcagaaagccatagaacatctgaaaaacaagactgctgttcagactcaaaatggc
ggcacgttcgagatgctaatcggtgggggtgatcccaggaccaccccggccaccagggga
acggacaggcctgcggtcacagagcccaaatccacccagggaaacagtggcccggaggca
cagaggaccttggagacttccccggagctgccaacgggagtggctgattcctgggggacc
gggttcccctccactcccaaggctccggatggaggagcgccagctggatcccagaaaact
gagtttttcaacgctgctgccctcaccaccgcaacgtcctggcagagttctgctgcctac
gatccctggtcaggcctctggactgcgggaaaggcctctgaggccctgcccacccaggcc
tcccccacccaggccccctccacccaggccccctccacccagaccccctccacccagacc
ccctccacccaggccccccccacccaggccccctctacccagaccctctctacccaggcc
ccccctacccacacccccaccatttcacacacagcctcagaaaagagtgttggccctgaa
ggccagcctatgtgggtcacgggagacgatctcacgccagagaactctctagggcctgag
gagacgggtcccgtttcggctcacacggatgctttcggggggcctgaaggtacgccccgt
ctctccacggtccctgtctcctctcagagggtccccagcagggagccagcggcctcaggc
agctggagctccaagtcggaggagcccatccatgccaccgtggacccccagaggctgggt
gtcctcatcactcctgtccccgactcgcacgcagctacccggaggcaggcggtagggctg
ttggccttccttggcctcctcttctgcctgggggtggccatgtttgcctaccagagcctc
cagggctgcccccgcaagctggcgggggacatggtggaggggcttcgctacgtcccccgg
agctgcggcagcaactcctatgtcctggtgccggtgtga

DBGET integrated database retrieval system