KEGG   Ursus arctos horribilis: 113252495
Entry
113252495         CDS       T05909                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04015  Rap1 signaling pathway
uah04062  Chemokine signaling pathway
uah04510  Focal adhesion
uah04670  Leukocyte transendothelial migration
uah04810  Regulation of actin cytoskeleton
uah04935  Growth hormone synthesis, secretion and action
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113252495 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113252495 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113252495 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    113252495 (BCAR1)
   04062 Chemokine signaling pathway
    113252495 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    113252495 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113252495 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    113252495 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113252495 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 113252495
NCBI-ProteinID: XP_026351016
UniProt: A0A3Q7UQX4
LinkDB
Position
Unknown
AA seq 870 aa
MEGPGAVNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPG
NRLKILVGMHDKKPAGPGPGPPTTSAQPQPGLHAPAAQYTPMLPATYQPQPDSVYLVPTP
SKTQQGLYQAPGPSPQFQSPPAKQTSTFSKQMPHHPFSSPAPDLYQVPPGPGSPAQDIYQ
VPPAAGIGHDIYQVPPSMDARSWEGTKTPAKVVVPTRVGQGYVFEASQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLPLS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTRHPLVLAAPPPDSLPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEAADGSVADDNVYAVPPPAEREA
PTEAKRLSASSTGSTRSSQSASSLEAAVPGREPLELEVAVEALARLQQGVSATVAQLLDL
AGSAGGGGGWRGAVEPQEPLVQDLRAAVAAVQGAVHELLEFARGAIGNAAHTSDRTLHAK
LSRQLQKMEDVYQTLVAHGQALDGGRGGPGATPEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKVPVPGPEGGGPLHPNPIDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
AAAQDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggagggaccaggggcagtgaacgtgctggccaaagccctctatgacaacgtggccgag
tctccggatgagctctccttccgcaagggcgacatcatgactgtgctggagcgggacaca
cagggcctggatggctggtggctctgctcactgcatgggcgccaaggcattgtgcctggg
aaccgccttaagatcctggtgggcatgcacgacaagaagccagcaggacctggacccggc
ccacccaccacctcggcccagccccagcctggcctgcacgccccggctgcccagtacacg
cccatgcttcctgccacataccagccccagcctgatagcgtctacctagtgcccaccccc
agcaagactcagcaaggcctctaccaagcccctgggcccagcccacagttccagtctccc
ccagcgaagcagacatctacattctcgaagcagatgccccatcaccctttttccagccca
gccccagacctttaccaggtgcccccagggcctggcagccccgcccaggacatttaccag
gtgccacctgctgctggaatagggcatgacatctaccaggtgcccccatctatggacgca
cgcagctgggaggggacgaagacaccggcaaaggtggtggttcccacccgcgtgggccaa
ggctatgtgttcgaggcctcccagccggagcaggatgagtacgacatcccacgccacctg
ctagccccggggccccaggacatctatgacgtgccccctgttcgggggctgcttcccagc
cagtatggccaagaggtctatgacacgccacccatggctgtcaagggtcctaatggccgg
gatccatcactggatgtgtatgacgtgccccccagtgtggagaagggcctgccgttgtcc
aaccaccacgcggtatatgatgttcctccgtcagtgagcaaggacgtgcctgatggcccg
ctgctgcgtgaggagacctatgacgtgccccccgcctttgccaaggccaagccctttgac
ccgacccgccacccgctggtccttgctgcgccccctccggactcccttccagccgaggat
gtgtatgacgtgcctccccctgcgcctgacctctatgatgtgccccctggcttgagacgg
cccggccctggcaccctctatgacgtgccccgcgagcgggttcttcctcctgaggcggcc
gacggcagtgtggccgacgacaacgtgtacgcagtgccaccccctgcagagcgagaggcc
ccgaccgaggccaagcggctgtcggcctccagtacaggcagcacgcgcagcagccagtcg
gcctcgtccctggaggccgcggtgccaggccgcgagcccctggagctggaggtggcggtg
gaggccctggcacggctgcagcagggcgtgagtgccaccgtagcccagctcctggacctg
gcgggcagcgccggcgggggtgggggctggcgtggcgctgtcgagcctcaggaacccctg
gtgcaggacttgcgggccgccgtggcagccgtccagggcgccgtccacgagctgctggag
ttcgcccgtggcgccatcggcaacgccgcgcacacttctgaccgcactctgcatgctaag
cttagccggcagctgcagaagatggaggatgtgtaccagacgctggtggcccatggtcag
gccctcgacggtggccggggaggcccaggggccactcctgaagacctggaccgcctggtg
gcctgctcacgggctgtgcccgaggacgccaagcagctggcctccttcttacatggcaat
gcctcgctgctcttcagacggaccaaggtccccgtgccggggccggaggggggcggcccc
ctgcaccccaaccccatcgacaaggccagcagcatccagtcccggcccctgccctcaccc
cctaagttcacctcccaggactccccagacgggcagtacgagaacagtgaggggggctgg
atggaggattacgactatgtccacctacaggggaaggaagagtttgagaagacccagaag
gagctgctggaaaagggcaacatcatgcggcaggggaagggccagctggagctgcagcag
ctgaagcagttcgagcgcctggagcaggaggtgtcccggcccatagaccacgacctggcc
aactggacgccggcgcagccgctggccccggggcggacgggcggcctggggccctcggac
cggcagctgctgctcttctacctggagcagtgtgaggccaacctgaccaccctgaccaac
gcggtggatgccttcttcaccgccgtggccaccaaccagccacccaagatcttcgtggca
cacagcaagttcgtcatcctcagcgcccacaagctggtgttcattggggacacgctgtcg
cggcaggccaaggcggccgacgtgcgcagccaggtgacccactacagcaacctgctgtgt
gacctcctgcgtggcatcgtggccaccaccaaggccgctgccctgcagtacccgtcgccc
gccgctgcccaggacatggtggacagggtcaaggagctgggccacagcacccagcagttc
cgccgggtcctgggccagctggcagctgcctga

DBGET integrated database retrieval system