KEGG   Ursus arctos horribilis: 113252704
Entry
113252704         CDS       T05909                                 

Gene name
TG
Definition
(RefSeq) thyroglobulin
  KO
K10809  thyroglobulin
Organism
uah  Ursus arctos horribilis
Pathway
uah04918  Thyroid hormone synthesis
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    113252704 (TG)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113252704 (TG)
SSDB
Motif
Pfam: Thyroglobulin_1 COesterase Ephrin_rec_like Abhydrolase_3
Other DBs
NCBI-GeneID: 113252704
NCBI-ProteinID: XP_026351166
UniProt: A0A3Q7URC9
LinkDB
Position
Unknown
AA seq 2763 aa
MGLALWVFSLLGSACLVSANIFEYQVDAQPLRPCELQREEAFLKGADHVPQCTEDGSYQT
VQCRNDGGSCWCVDADGREVPGSRRPARPAACPSFCQLQKQRILLSGYLNGTATAYLPQC
QDSGDYAPVQCDLGREQCWCVDTEGMEVYGTRQRGRPTRCPRSCEIRNRRLLHGVGDKSP
PQCSPDGGFLPVQCKFVNTTDMMIFDLVQSYNRFPDAFVTFSAFRKKFPEVSGYCHCADS
QGRELAETGLELLLDEIYDTIFAGLDLASTFAESTLVRILQRRFLAVQLVVSGRFRCPTK
CEVERFTASSFGHPYIPSCRRNGGYQAVQCQRGGPCWCADAQGKEIHGTQRQGERPSCAE
DQFCASERRQALSRLHFGPSGYFSQHRLFLAPEGRQVSPRVARFVTSCPPLIKELFVDSG
ILHPMVEGQDQQFSASETLLREAIGAIFPSRELARLALQFTTDPKRLQQNLFGGKFLVNV
GQFNLSGALGTKGTFNFSQFFQQFGLPGFRNGGTNLSKPLSLGFDADPATEPPEASKKGA
ATNRPIVGSFGFEINLQENQNALTFLSSLLELPEFLLFLQQALSVPEDIARDLGDVMEIV
LSSQGCEQTPGSLFVPRCSAEGSYEDVQCFAGECWCVDSRGKELAGSRVRGARPRCPTEC
EKQRALMRILSGSLPAGASLFVPSCSSEGHFLPVQCFNSECYCVDAEGQAIPGTRSVPGE
PKPCPTPCQLQAEKAFLGVARALGSGSSMLPSFSSSYVPQCSTSGQWRPVQCDGPPEQAF
EWYERWGAQNNSGQELTPAELLGKIMSYREAASGSFQLFIQNLYEAGQQGIFPGLARYPS
FQDIPLAVMEGNLTQPGGNILLEPYVFWQILNGQLSRYPGPYSDFSTPLAHLDLRSCWCV
DEAGQELEGTRTEPSKAPACPGSCEKVKLRVLQFIKETEEIVLASNSSWFPLGESFLAAK
GIRLTDEELSLPPLSPSRESFSEKFLSGGDYAIRLAAQSTLDFYQRRGFLLGDSTRASAL
PRPGPYVPQCDAWGGWEPVQCHAGTGYCWCVDGKGEYVPASLTARSPQIPQCPTSCETSR
ASGLLSSWKQAASQGNPSPKDLFIPTCLETGEFARLQESEAGSWCVDPASGAGMPPGTNS
STPCPSLCEVLPSGVLSKRASSVYTPACRAEDGGFSPVQCDPAQGSCWCVLDSGEEVPGT
RVAGSQLACESPQCPLPFNTSDVAGGVILCERASGAGGAPVQRCQLWCHRGYQSAFPPGL
LVCSLEKGRWESQPPQPQACQRPQLWQTLQTQGQFQLRLPPGKMCSADYAGLLLAFQVFI
LDELMARGFCEIQAKTFGTPVSIPVCDGSTVQVDCLAGERLGVNVTWKLQLKDVPPASLP
DLHDIEEALVGKDLIGRFTDLIQSGGFQLHLDSKTFPADTSIYFLQGDRLGTSPRTWFGC
LEGFRQVLATSNATQDPLGCVKCPEGSYFQKEICIPCPVGFYQERAGSVACIRCPMGRTT
ISPGAFSPMHCVTDCQRSEAGLQCDQDGQYRASQRDRDSRKAFCVDGEGRRLPWSETDGP
LSDSQCLMMRKFEKALESQVIFGANVTAVGRSKVPGSESPLMQCLTDCALDTACSFLTVS
SAGSEVSCDFYAWSSDNIACVTSAQHQDTLGNSKATGSGSLRCQVTVRSGAQDPPSVYLK
KGHEFNTTSQKSFEQTGFQNTLSGMYGPVVFPASGADLTGAHLFCLLACDRDSCCDGFIL
AQVQGGPIICGLLSSPDVLLCNVKDWRDPAEAQANATCPGVTYDQGSRQVTLRLGGQEFQ
SNLRPMEGSPDTITSFQQVYLWKDSDMGSRPESLGCRRDVEPRAASPTETDLTTELFSPV
DLNQIIVNGSRSLPSQQHWLFKHLFSPQQANLWCLSRCVQEPSFCQLAEITDNAPLYFTC
ALYPEAQVCDDVMESNPKGCRLILPHRPKTLFRKKVILRDKVKHFYTRLPFQTLTGISVR
NKVPMSEKSISSGFFECERLCDADPCCTGFGFLNVFQLKGGEVTCLTLNSLGLQTCTEEN
RGAWRILDCGSPDTEVRTHPFGWYQKPVAQNDAPSFCPSVVLPSLPEKVALGSWQSLAPS
AVVVDPSIRNFDVAHISTATTSDFSDARNFCLLECSRHQACLVTTLQTRPGAVRCVFYAD
TQICTHSLQAQHCQLLLREEATYIYRKLNIPLLSSGTPAPSVTIAPYGRLLGRSQAVQVG
GSWRQVDQFLGVPYAAPPLAESRFQAPGTLNWTGSWDATKPRASCWQPGTRAPASPGVSE
DCLYLNVFVPQNVAPNASVLVFFHNTMEGKGAGGQLAIDGSFLAAIGNLIVVTAGYRVGV
FGFLSSGSGEVSGNWGLLDQRAALTWVQTHIGVFGGDPRRVTLAADRGGADVASIHLLTT
RAADSRLFRRVMLMGGSAFSPAAVISQGRAQQQAAALAEEISCPTSSMQEMVSCLRQKPA
SVLNDAQTKLLAVSGPFHYWGPVVDGQYLREAPARALQRTPRVKVDLLIGSSQDDGLINR
AKAVKQFEESQGRTSSKTAFYQALQNSLGGEDADAGVRAAATWYYSLEHSTDDYASFSRA
LENATRDYFITCPVIDMASHWARRARGNVFMYHAPESYGHSSLDLLADVRSAFGLPFYPA
YEGQFTLEEKSLSLKIMQFFSNFIRSGNPNYPHEFSRKAPEFAAPWPDFVPRAGGESYKE
LSVLLPNRQGLKSADCSFWSKYIRSLKAAAAGGEAGLSAESEEEDGLADTGLLGEPGSKS
YSR
NT seq 8292 nt   +upstreamnt  +downstreamnt
atgggcctggccttgtgggtcttcagtctgctgggctcagcctgcttggtgtcggccaac
atcttcgagtaccaggtggacgcccagcccctgcgtccttgcgagctgcagagggaggag
gcctttctgaagggagcagaccacgttccccagtgcacagaagacggcagctaccagacc
gtccagtgccggaatgacgggggctcctgctggtgcgtggatgccgacggcagggaggtg
cccggcagcaggcggcctgctcggcccgcggcctgtccatctttctgccaactgcagaag
cagcggatcttgctgagcggctaccttaacggcacggccacagcctacctcccccagtgt
caggattcgggggattacgcgcccgtgcagtgtgacctggggcgggagcagtgctggtgt
gtggacacagaagggatggaggtgtacgggacacgccagcgagggaggccgacacggtgt
cccaggagctgtgagataagaaaccgccgtctcctccacggggtgggagacaagtcacct
ccccagtgttctccagatgggggcttcctgcctgtccagtgcaagtttgtcaacaccaca
gacatgatgatttttgacctggttcagagctacaacaggtttccagatgccttcgtgacc
ttcagtgccttccggaaaaagttccccgaggtgtctgggtattgtcactgtgcggacagt
caagggcgggagctggctgagacaggtttggagctgttacttgacgaaatttacgacacc
atctttgccggcctggacctcgcttccacgttcgccgaaagcaccctggtgcggatattg
cagagacggttcctagccgttcagctcgtcgtctctggccgattccgatgccccacaaaa
tgtgaagtggagcggttcacagcgagcagctttggtcacccctacattccgagctgccgc
cgcaacgggggctaccaggcggtgcagtgccagcggggagggccgtgctggtgtgcggac
gcccaagggaaggagatccatggaacacagcggcaaggcgaacgaccgtcctgtgctgaa
gaccaattctgtgcctcagagaggaggcaggccctgtctagactacacttcgggccctca
ggctacttcagccagcacaggttgttcttggctcctgagggaagacaggtgtctccgaga
gtagccagatttgtcacatcctgcccacccctgatcaaggagctctttgtggactctggg
attctccacccaatggtagaagggcaggaccaacagttttctgcctcagaaactctcctc
agagaagccattggagcgatttttccttcccgagagctggctcgtcttgcccttcagttt
accaccgacccaaagcgcctccagcaaaacctctttggagggaaatttttggtgaatgtt
ggccagttcaacctgtctggagcccttggcacaaaaggcacatttaacttcagtcaattt
ttccagcagtttggtctcccaggcttccggaatggagggaccaatctatccaagcccctc
tccttgggatttgatgcagatcctgccacagaaccccctgaagcctctaagaagggagct
gctacgaataggccgattgtgggcagctttggctttgagatcaacttgcaagagaaccaa
aatgccctgacattcctttcctctctcctggagcttccagaattccttctcttcctgcag
caggctctttcggtgccagaagacatagcgagggatctgggtgacgtgatggaaattgtg
ctcagctcccagggctgtgagcagacgcctggcagtcttttcgtcccacggtgctcggca
gaaggaagctacgaggatgtccagtgctttgccggggagtgctggtgtgtggattcccgg
ggcaaagaacttgctggctccagggttaggggtgcacggcccaggtgccccacagagtgt
gagaagcaaagggctctcatgcgaatcctctcgggcagcctgcccgctggggccagcctg
tttgtcccttcttgtagcagcgaggggcatttcctacccgtccagtgcttcaactcagag
tgctactgcgtggacgccgagggtcaggctattcctggaactcgaagcgtgcctggagag
cccaagccatgccccaccccctgtcagttacaggccgagaaagccttccttggggtcgcg
cgagcgctgggctccggttccagcatgctgccctccttctccagcagctacgtcccgcag
tgcagcaccagcgggcagtggaggcccgtgcagtgcgacgggccccccgagcaggccttc
gagtggtacgagcgatggggggcccagaacaacagtggccaggagctgacccctgctgag
ctgctagggaagatcatgagctatcgagaagcagcttccggaagcttccaactctttatt
caaaatctgtatgaggctggccaacagggcatcttcccagggctggcgagatacccttct
ttccaagacatcccgctggcggtgatggaaggcaacctgacccagcctggtgggaacatc
cttctggaaccctacgtcttctggcagatcctgaatggccagctcagccggtacccaggg
ccctactcagacttcagcactcctctggcgcacttggaccttcggagctgctggtgcgtg
gatgaagctggtcaagaactggaaggcacccggacagagccgagcaaggccccagcatgt
cctggctcttgtgagaaggtgaagcttcgtgtcctgcagttcattaaggaaacagaagag
attgtcttggcttccaacagttcttggttccctctgggagagagtttcctagcggccaaa
ggaatccggctgaccgatgaggaactctcccttcctccactctctccatcccgggagtct
ttctcagagaagtttctgagtgggggcgattatgccattcgtctggcggctcagtctacc
cttgacttctatcaaagacgtggctttctcctgggggattccacacgcgcatccgccctt
ccgcggcccggcccctacgtgccccagtgtgatgcgtggggaggctgggagcccgtgcag
tgccatgccgggactgggtactgctggtgtgtggacgggaagggagagtacgtccctgcc
tcgctgactgcccgctccccacagatcccccagtgccccacctcctgtgagacatctcga
gccagtgggctgctttccagttggaaacaggctgcatcccagggaaacccatctccaaaa
gacctgttcatcccaacctgcctggagacaggagagtttgccaggctgcaggagtcggag
gccggcagctggtgtgtggacccggcctcgggggccggcatgccacccggcacgaacagc
agcaccccatgcccgagcctctgtgaagtactcccgagtggggtcctgtccaagagagcc
agctcagtctataccccagcctgcagggcagaagatggaggattttcccccgtgcagtgt
gatccagcccagggcagctgctggtgtgtcctggacagtggagaggaggtgcctgggacc
cgtgtggccgggagccagctggcctgtgagagcccccagtgcccgctgcccttcaacacg
tcggatgtggctggtggagtgatcctgtgtgagcgagcctcgggcgcgggaggggccccc
gtccagcggtgccagctgtggtgccaccggggctaccagagtgcctttccgccggggctg
ctggtgtgcagccttgagaagggacgctgggagtcccaaccgccccagccccaggcctgc
cagcggccccagctctggcagaccctccagacccaagggcagttccagctccggctcccg
ccaggcaagatgtgcagcgctgactatgcgggcttgctgctggccttccaggtgttcata
ttagacgagctcatggcccggggcttctgtgagatccaggcgaagacgtttgggacccct
gtttccattcctgtctgtgacggatccacggtgcaggtggactgtctggccggggagcgt
ttaggagtgaacgtcacgtggaagttgcagctgaaggacgtcccaccggcctctcttcct
gatttgcatgacattgaggaagccttagtcggcaaggatctcattggacgcttcacagat
ctgatccagagtggagggttccagcttcatctagattccaagacattcccagcagacacc
tccatctatttccttcaaggagaccgccttggcacctctcccaggacatggtttgggtgc
ttggaaggattccgccaagtcttggctaccagcaatgccactcaggacccactggggtgc
gttaagtgtcctgaaggaagctattttcagaaggagatttgtattccctgtcctgttgga
ttctaccaagaacgggcagggagcgtggcctgcatccgatgtcccatgggcagaacgacc
atttcccctggagctttcagccccatgcactgtgtcactgactgtcagaggagcgaggct
gggctgcagtgtgaccaggacggccagtaccgagccagccagagagacagggacagtcgg
aaggccttctgcgtggacggcgaggggcggaggctgccgtggtcggaaacagacggcccg
ctctctgactcccagtgtctgatgatgcggaaatttgagaaggctctagaatctcaggtg
atcttcggtgccaatgtcactgcagtgggcaggtccaaagttcctggctctgagtccccc
ctgatgcagtgcttgacagactgtgctttggacacggcctgcagcttcctcacggtgtcc
tcggcgggatcagaggtctcgtgtgatttttatgcttggagcagcgacaacatcgcctgc
gtgacttcggctcagcatcaagacacactggggaactcaaaggccaccggctctggaagt
cttaggtgccaggtgacggtgaggagcggggctcaagatcccccgtctgtgtatctgaaa
aagggccacgagttcaacacaacgagtcagaagagctttgagcaaacgggtttccagaac
acactctctggaatgtacgggcccgttgtgttcccagcctctggagctgatctgacaggg
gctcatctcttctgtcttctggcgtgtgaccgtgattcgtgctgtgacggcttcatcctt
gcccaggtccaaggaggtcccatcatctgtgggttgctgagctcccccgatgtcctactt
tgcaatgtcaaggactggagggaccccgctgaagcccaggccaatgccacatgtcctggt
gtgacatacgaccaggggagccgccaggtgacgttgcgtctgggaggccaggagttccag
agtaatctgagacccatggaaggatctccggacaccattaccagcttccaacaggtttat
ctctggaaagattctgacatggggtctcgacctgagtccctgggatgtagaagagacgta
gaaccaagggcagcctctccaacagaaacagatttgacgacagaacttttctcccctgtg
gatcttaaccagattattgtcaacggaagccgatctctgcccagccagcagcactggctt
ttcaaacacctgttttcacctcagcaggcaaacctgtggtgcctgtctcgctgtgtgcag
gagccctctttctgtcagctggcggagataacagacaacgcacccttgtatttcacctgt
gccctctacccagaggcccaggtgtgtgacgatgtcatggagtccaatcccaagggctgc
agactgatcctgccccacaggccaaagaccctattccggaagaaagttatactgagagat
aaagtgaagcacttttacactcgcctgccattccaaacattgacggggatttccgttaga
aacaaagtgcccatgtctgaaaaatccatttccagtggcttcttcgaatgtgaacggcta
tgtgacgcggacccgtgctgcaccggctttggctttctcaatgttttccagttgaaagga
ggagaggtgacatgcctaactctaaacagcctgggacttcagacgtgcactgaggaaaac
agaggagcctggcgcattttggactgtggctctcctgacacagaggtccgcacccatccc
tttggatggtaccagaaacctgttgctcagaatgatgctcccagtttttgcccctccgtg
gttctgccttccctcccggagaaagttgctctgggctcatggcagtccctggccccctct
gcggtagttgttgacccgtccatccggaacttcgatgttgctcacatcagcactgccacc
accagcgacttctctgatgccagaaacttctgtttgttggaatgttcccgtcaccaggcc
tgcctcgtcaccactctgcagacccgacctggtgctgtgaggtgtgtattctatgctgac
acccagatctgcacacatagcctgcaggcccagcactgccaacttctgctccgggaggag
gccacctacatctaccggaagctgaacatccctctgctcagctctgggacacctgcacct
tctgtgaccatcgccccctacggccggctgctgggcaggtcccaggccgtccaggtgggc
ggttcgtggaggcaagtggatcagttcctgggagttccgtacgccgccccgcccctggca
gagagccgcttccaggcaccggggaccttgaactggacagggtcctgggatgccaccaag
ccacgggccagctgctggcagccaggcaccagagcgcccgcgtcgcccggagtcagcgaa
gactgcttgtatcttaacgtgtttgtccctcagaacgtggcccccaacgcgtctgtgctg
gtcttcttccacaacaccatggaggggaagggggctggaggacagctggccatcgatggc
tccttcctggctgctattggcaacctcattgttgtcactgctggctaccgagtgggggtc
ttcggcttcctgagttccggttctggcgaggtgagtggcaactgggggctgctggaccag
cgggcggctctgacctgggtgcagacccacatcggagtgttcggtggggaccctcggcgc
gtgaccctggcagcagatcgtggcggtgccgacgtggccagcatccaccttctaaccacc
agggccgctgactccagactcttccggagggtcatgctgatgggtggctccgcgttctcc
ccagctgctgtcatcagccaggggagggctcagcagcaggcagccgctttggcagaggag
atcagctgccccacctcgtccatgcaagaaatggtgtcctgtctccgccagaagcctgcc
agtgtcctcaatgacgcccagaccaagctcctggccgtgagtggccctttccactactgg
ggtcctgtggttgatggccagtacctccgagaggctccggcaagagctcttcagaggaca
ccgcgggtgaaggtcgatctgctgattgggagttctcaagatgacgggctcatcaacaga
gcgaaagctgtgaagcaatttgaggaaagtcaaggccggaccagtagcaagacagccttt
taccaggcgctgcagaattcgctgggcggtgaggacgcagacgccggtgtccgggcggct
gctacttggtactactccttggaacattccaccgatgactacgcctccttctcccgggcc
ctggagaacgccacccgggactactttatcacctgtcctgtaatcgacatggccagccac
tgggcgaggagggcccgaggaaacgtcttcatgtaccacgctcccgaaagctatggccac
agcagcctggatttgctggcggatgttcggtctgcctttgggcttcctttctaccccgcc
tacgaggggcagtttactctggaggagaaaagcctgtccctgaagatcatgcagttcttt
tcgaacttcatccgatcgggaaaccccaactacccgcatgagttctccaggaaagcccct
gagtttgcagccccgtggcctgacttcgtcccgcgggccggcggggagagctacaaggag
ctcagcgtcctgctccccaatcgacagggcctcaaaagcgctgactgctccttctggtcc
aagtacatccggtctctgaaggcggcggcggcaggtggggaagccggattgtcagcagag
agtgaagaggaggacgggctggctgacactgggctgttaggagagccaggctccaagagc
tacagcaggtga

DBGET integrated database retrieval system