KEGG   Ursus arctos horribilis: 113252726
Entry
113252726         CDS       T05909                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04110  Cell cycle
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04350  TGF-beta signaling pathway
uah04390  Hippo signaling pathway
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04630  Jak-STAT signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05132  Salmonella infection
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05213  Endometrial cancer
uah05216  Thyroid cancer
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113252726 (MYC)
   04012 ErbB signaling pathway
    113252726 (MYC)
   04310 Wnt signaling pathway
    113252726 (MYC)
   04350 TGF-beta signaling pathway
    113252726 (MYC)
   04390 Hippo signaling pathway
    113252726 (MYC)
   04630 Jak-STAT signaling pathway
    113252726 (MYC)
   04151 PI3K-Akt signaling pathway
    113252726 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113252726 (MYC)
   04218 Cellular senescence
    113252726 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113252726 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113252726 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113252726 (MYC)
   05202 Transcriptional misregulation in cancer
    113252726 (MYC)
   05206 MicroRNAs in cancer
    113252726 (MYC)
   05205 Proteoglycans in cancer
    113252726 (MYC)
   05230 Central carbon metabolism in cancer
    113252726 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113252726 (MYC)
   05225 Hepatocellular carcinoma
    113252726 (MYC)
   05226 Gastric cancer
    113252726 (MYC)
   05216 Thyroid cancer
    113252726 (MYC)
   05221 Acute myeloid leukemia
    113252726 (MYC)
   05220 Chronic myeloid leukemia
    113252726 (MYC)
   05219 Bladder cancer
    113252726 (MYC)
   05213 Endometrial cancer
    113252726 (MYC)
   05224 Breast cancer
    113252726 (MYC)
   05222 Small cell lung cancer
    113252726 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113252726 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113252726 (MYC)
   05161 Hepatitis B
    113252726 (MYC)
   05160 Hepatitis C
    113252726 (MYC)
   05163 Human cytomegalovirus infection
    113252726 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113252726 (MYC)
   05169 Epstein-Barr virus infection
    113252726 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113252726 (MYC)
   03019 Messenger RNA biogenesis [BR:uah03019]
    113252726 (MYC)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    113252726 (MYC)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     113252726 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 113252726
NCBI-ProteinID: XP_026351197
UniProt: A0A3Q7WL24
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPARGPGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSSGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQTEEQKLISEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctgaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtacag
ccttatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctcggggctctgctcgccctcctacgttgcagtcgcgtccttc
tcccccaggggggacgacgacggcggcggcggcagcttttccacggccgaccagttggag
atggtgaccgagctgctgggaggggacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gcagccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcagc
agcccgagccccgcccgcgggcccggcggctgctccacctccagcctgtacctacaggac
ctgagcgccgccgcctccgagtgcatcgacccgtccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctccccggactccaccgccttctccccgtcctcg
gactctctgctctcctcggccgagtcctccccgcgggccagccccgagcccctggcgctc
cacgaggagacaccgcccaccaccagcagcgactcggaggaagaacaagaggacgaagaa
gaaattgatgttgtttctgtggaaaaaaggcagccccctgccaaaaggtcagaatcgggg
tcaccgtcgtcgggaagccacagcaaaccacctcatagcccgctggtccttaaaagatgc
catgtgtccacccatcagcacaattacgcagcgcccccctccaccaggaaggactatccg
gccgccaagagggctaagttggacagtggcagggtcctgaaacaaatcagcaacaaccgt
aaatgcgccagccccaggtcttcggacacagaggagaacgacaagaggcggacacacaac
gtcttagaacgccagaggagaaacgagctgaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggttgtcatccttaaaaaagccacc
gcgtacatcctgtccgtccaaacagaggagcagaagctcatctcagaaaaggacttgttg
cggaagcggcgagaacagttgaaacacaaacttgaacagctaaggaactctggtgcctaa

DBGET integrated database retrieval system