KEGG   Ursus arctos horribilis: 113253781
Entry
113253781         CDS       T05909                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04064  NF-kappa B signaling pathway
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113253781 (MYD88)
   04064 NF-kappa B signaling pathway
    113253781 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113253781 (MYD88)
   04621 NOD-like receptor signaling pathway
    113253781 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113253781 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113253781 (MYD88)
   05135 Yersinia infection
    113253781 (MYD88)
   05133 Pertussis
    113253781 (MYD88)
   05134 Legionellosis
    113253781 (MYD88)
   05152 Tuberculosis
    113253781 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113253781 (MYD88)
   05162 Measles
    113253781 (MYD88)
   05164 Influenza A
    113253781 (MYD88)
   05161 Hepatitis B
    113253781 (MYD88)
   05168 Herpes simplex virus 1 infection
    113253781 (MYD88)
   05169 Epstein-Barr virus infection
    113253781 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    113253781 (MYD88)
   05145 Toxoplasmosis
    113253781 (MYD88)
   05140 Leishmaniasis
    113253781 (MYD88)
   05142 Chagas disease (American trypanosomiasis)
    113253781 (MYD88)
   05143 African trypanosomiasis
    113253781 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 113253781
NCBI-ProteinID: XP_026352516
UniProt: A0A3Q7UV70
LinkDB
Position
Unknown
AA seq 296 aa
MAAEVSGAESASAVCSTSSLPLAALNVRVRRRLSLFLNVRTQVAADWTALAEEMGFEYLE
IRHLETHADPTGKLLDDWQGRPGASVGRLLELLTKLGREDVLVELGPSIEEDCQKYILKQ
QQEESEKPLQVPAVDSSDPRTPERGGITMLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcagaagtctccggcgcggagtccgcgtccgcggtctgctctacgtcctccctg
cccctggctgctctcaacgtgcgagtgcggcgccgcctgtcgctgttcctgaacgtgcgg
acgcaggtggcggccgattggaccgcgctggccgaggagatgggcttcgagtacttggag
atccggcatctggagacgcacgctgaccccacgggcaagctgctggacgactggcaggga
cgccctggggcctcggtgggccgcctgcttgagctgctcaccaagctgggccgcgaggac
gtgttggtggaactggggcccagcatcgaggaggattgccaaaagtatattctgaaacag
cagcaggaggagtctgagaagcccttacaggtgcctgctgtagacagcagtgacccacgg
acaccagagcggggcggcatcaccatgcttgatgaccccttggggcaaatgcccgagcgt
tttgatgccttcatctgctactgccccagcgatatccaatttgttcaggagatgatccgg
cagctggaacagacaaactatcggctgaagttgtgtgtatccgatcgtgatgtcctgcct
ggcacctgtgtctggtccattgccagtgagctcattgaaaagaggtgccgccggatggtg
gtggttgtctctgatgattacctgcaaagcaaggaatgtgacttccagactaagtttgca
ctcagcctctctccgggtgcgcatcagaagcgattgatccccatcaagtacaaggcaatg
aagaaagagttccccagcatcctgcggttcatcaccgtctgtgactacacaaacccctgc
accaagtcctggttctggactcgcctcgccaaggccctgtccctgccctga

DBGET integrated database retrieval system