KEGG   Ursus arctos horribilis: 113253847
Entry
113253847         CDS       T05909                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04144  Endocytosis
uah04218  Cellular senescence
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04390  Hippo signaling pathway
uah04520  Adherens junction
uah04659  Th17 cell differentiation
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05142  Chagas disease
uah05161  Hepatitis B
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05220  Chronic myeloid leukemia
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113253847 (TGFBR2)
   04350 TGF-beta signaling pathway
    113253847 (TGFBR2)
   04390 Hippo signaling pathway
    113253847 (TGFBR2)
   04068 FoxO signaling pathway
    113253847 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113253847 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113253847 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    113253847 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113253847 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113253847 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113253847 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113253847 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113253847 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    113253847 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113253847 (TGFBR2)
   05212 Pancreatic cancer
    113253847 (TGFBR2)
   05225 Hepatocellular carcinoma
    113253847 (TGFBR2)
   05226 Gastric cancer
    113253847 (TGFBR2)
   05220 Chronic myeloid leukemia
    113253847 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113253847 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113253847 (TGFBR2)
   05161 Hepatitis B
    113253847 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    113253847 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113253847 (TGFBR2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     113253847 (TGFBR2)
Protein kinases [BR:uah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   113253847 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 113253847
NCBI-ProteinID: XP_026352640
UniProt: A0A3Q7VKE6
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPQVQKSVNNDMMVTDNNGVIKFPQLCKFCDVRSST
CDNQKSCVSNCSITSICEKPHEVCLAVWRKNDENITLETLCHDPKDTYHGIVLEDSASPK
CIMKEKKVLGETFFMCSCSSDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIVTFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcaagttcagaagtcggttaataatgacatgatggtcaccgac
aacaatggtgtcatcaaatttccacaattgtgtaaattttgcgatgtgagatcttccacc
tgtgacaatcagaaatcctgcgtgagcaactgcagcattacatccatctgtgagaagcca
catgaagtctgtctggcggtctggagaaagaatgatgagaacataacactagagacgctt
tgccatgaccccaaggacacctaccacggaattgttctcgaagattctgcttctccaaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagctct
gatgagtgcaatgactacatcatcttctcggaagaatatgccaccaacaaccctgacctg
ttgttagtcatatttcaagtgacaggcgtcagcctcctgccaccactgggaatcgccata
gccgtcattgtcaccttctactgctaccgggttcaccggcagcagaagctgagcccgtcc
tgggagaccagcaagccacggaagctcatggagttcagcgagcacctggccatcattctg
gaagacgaccgctccgacatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagaacagttcgagaccgtggcggtcaagatcttccct
tatgaggagtacgcctcctggaagacagagaaggacatcttctcagacatcaacctgaag
catgagaacatcctgcagttcctgacggccgaggagcggaagacagagctggggaagcag
tattggctgatcacagccttccacgccaagggcaacctacaggagtacctcacgcggcac
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcattgctcac
ctgcacagtgaccataccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtcaagaacgacctgacctgctgcctgtgtgactttgggctt
tccctgcgcctcgacccgactctgtctgtggatgacctggccaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatctggagaacgttgaa
tcctttaagcagacggatgtctactccatggctctggtactctgggaaatgacatctcgc
tgcaatgcggtgggagaagtgaaagattacgagcctccatttggttccaaggtgcgggag
catccttgtgttgagagcatgaaggacaacgtgctgagagaccgagggcgaccagaaatt
cccagctcctggctcaaccaccagggcatccagacggtgtgcgaaactctgaccgagtgc
tgggaccacgacccggaggcccggctcacggcccagtgcgtggcggagcgcttcagcgaa
ctggagcacctggacaggctctcagggaggagctgctccgaggagaagattcccgaagat
ggctcgctgaacactaccaaatag

DBGET integrated database retrieval system