KEGG   Ursus arctos horribilis: 113253942
Entry
113253942         CDS       T05909                                 

Gene name
ACKR4
Definition
(RefSeq) atypical chemokine receptor 4
  KO
K04186  atypical chemokine receptor 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113253942 (ACKR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113253942 (ACKR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113253942 (ACKR4)
   04050 Cytokine receptors [BR:uah04050]
    113253942 (ACKR4)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113253942 (ACKR4)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113253942 (ACKR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 113253942
NCBI-ProteinID: XP_026352817
UniProt: A0A3Q7WEN9
LinkDB
Position
Unknown
AA seq 350 aa
MALEHNQSTDYYYEENEVNGTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGIAGNS
TVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKVTSALYT
VNFVSGMQFLACISIDRYWAVTKAPSQSGVGKSCWLICCCVWMAAILLSIPQLVFYTVNH
KARCIPIFPYHLGTSVKASIQMLEICIGFVIPFLIMGVCYFVTARTLIRMPNIKKSRPLK
VLFTVVIVFIVTQLPYNIVRFCQVIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNP
ILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEDPTEPTSTFSI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctttggaacacaaccagtcaacagattactactatgaggaaaatgaagtgaatggc
actcatgactacagtcagtatgaagtgatctgtataaaagaggaagtcagaaaatttgca
aaagttttcttgcctgccttcttcacaatagctttcatcattggaattgcaggcaattcc
acagtagtggcaatttatgcctattacaagaagcagagaaccaaaacagatgtgtacatc
ctgaatttggcagtggcagatttactccttctattcactctgcctttttgggcagttaat
gcagttcatggatgggttttagggaaaatcatgtgcaaagtcacttcagccttgtacaca
gtcaacttcgtctctggaatgcagttcctggcttgtatcagcatagacagatactgggca
gtaactaaagctccaagtcaatcaggagtggggaaatcatgctggcttatctgttgctgt
gtctggatggctgccatcttgctgagtatacctcagctggttttttatacagtaaatcac
aaggctaggtgcattcccatctttccatatcacctaggaacatcagtgaaagcatcaatt
caaatgctggaaatctgcatcggatttgtaataccctttcttattatgggagtgtgctac
tttgtcacagcaaggacactcatcaggatgcccaatattaaaaaatctcgacccctcaaa
gttctgttcaccgtggttatagttttcattgtcacgcagctgccttataacattgtcagg
ttctgccaagtcatagacatcatctactccctgatcaccgactgcgacatgagcaaacgc
atggatgttgccatccaaatcacagagagcattgcattgtttcacagctgcctcaaccca
atcctgtatgttttcatgggcgcctcttttaaaaactacatcatgaaagttgctaagaaa
tacgggtcctggagaagacaaagacaaaacgtggaagagattcctttcgattcagaagat
cctacagagccaaccagtacttttagcatttaa

KEGG   Ursus arctos horribilis: 113265484
Entry
113265484         CDS       T05909                                 

Gene name
CCR7
Definition
(RefSeq) C-C chemokine receptor type 7 isoform X1
  KO
K04182  C-C chemokine receptor type 7
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113265484 (CCR7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113265484 (CCR7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113265484 (CCR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113265484 (CCR7)
   04050 Cytokine receptors [BR:uah04050]
    113265484 (CCR7)
   04090 CD molecules [BR:uah04090]
    113265484 (CCR7)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113265484 (CCR7)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113265484 (CCR7)
CD molecules [BR:uah04090]
 Proteins
  113265484 (CCR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3187
Other DBs
NCBI-GeneID: 113265484
NCBI-ProteinID: XP_026368673
UniProt: A0A3Q7X324
LinkDB
Position
Unknown
AA seq 390 aa
MDLGKPMKSLLVVALLVIFQRGRVALFPCPQVCLCQDEVTDDYIGDNTTVDYTLYESVCF
KKDVRSFKAWFLPIVYSIICFMGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAMADILFLL
TLPFWAYSAAKSWTFGVHVCKVIFGIYKISFFSGMLLLLCISIDRYVAIVQAVSAHRHRA
RVLFISKLSCAGIWMLAMVLSTPELLYSGLQKSSSEQTLRCSLNTEHVADLITIQVAQMV
VGFLIPLGAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIAFQLPYNGVVLAQTVA
NFNITGSGSCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLS
QERLRQWSSCRHTRRSSMSVEAETTTTFSP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggacctggggaaaccaatgaaaagcctgctggtggtggctctccttgtcattttccag
cggggtcgtgtcgccctgttcccttgcccgcaggtgtgcctgtgccaagatgaggtcacg
gatgattacatcggagacaacaccacggtggactacacgctttatgagtccgtgtgcttc
aagaaagacgtgcgcagcttcaaagcctggttcctgccaatcgtgtacagcatcatttgc
ttcatgggcctgctgggcaacgggctggttgtgctgacctacatctatttcaagaggctc
aagaccatgaccgacacctacctgctcaacctggccatggcggacatcctcttcctcctg
acccttcccttctgggcatacagcgcggccaagtcctggaccttcggcgtgcacgtttgc
aaggtcatctttggcatctacaagataagcttcttcagcggcatgctgctgcttctttgc
atcagcatcgaccgctacgtggccatcgtccaggccgtctcggcccaccgccaccgagcc
cgcgtccttttcatcagcaagctctcgtgcgcgggcatctggatgctggccatggtgctg
tccaccccagagctcctgtacagcggcctccagaagagcagcagcgagcaaacgctgcgg
tgctccctcaacaccgagcacgtggcagacttgatcaccatccaggtggcccagatggtg
gtaggctttctgatccccctgggggccatgagcttctgctacctcgtcatcatccgcacc
ctgctccaggcccgcaacttcgagcgcaacaaggccatcaaggtcatcatcgccgtggtc
gtggtcttcatcgccttccagctgccctacaacggggtggtcctggcccagacggtggcc
aacttcaacatcacgggcagcggcagctgtgagctcagcaagcagctcaacatcgcctat
gacgtcacctacagcctggcctgcgtccgctgctgcgtcaaccctttcttatatgccttc
attggcgtcaagttcaggagcgacctcttcaagctctttaaggacttgggctgcctgagc
caggagcggctccggcagtggtcttcctgccgccacacccggcgctcctccatgagcgtg
gaggccgagaccaccaccaccttctccccgtag

DBGET integrated database retrieval system