KEGG   Ursus arctos horribilis: 113253989
Entry
113253989         CDS       T05909                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113253989 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113253989 (PIK3CB)
   04015 Rap1 signaling pathway
    113253989 (PIK3CB)
   04012 ErbB signaling pathway
    113253989 (PIK3CB)
   04370 VEGF signaling pathway
    113253989 (PIK3CB)
   04630 Jak-STAT signaling pathway
    113253989 (PIK3CB)
   04668 TNF signaling pathway
    113253989 (PIK3CB)
   04066 HIF-1 signaling pathway
    113253989 (PIK3CB)
   04068 FoxO signaling pathway
    113253989 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    113253989 (PIK3CB)
   04072 Phospholipase D signaling pathway
    113253989 (PIK3CB)
   04071 Sphingolipid signaling pathway
    113253989 (PIK3CB)
   04024 cAMP signaling pathway
    113253989 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    113253989 (PIK3CB)
   04152 AMPK signaling pathway
    113253989 (PIK3CB)
   04150 mTOR signaling pathway
    113253989 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113253989 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    113253989 (PIK3CB)
   04218 Cellular senescence
    113253989 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113253989 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    113253989 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113253989 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113253989 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    113253989 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    113253989 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    113253989 (PIK3CB)
   04660 T cell receptor signaling pathway
    113253989 (PIK3CB)
   04662 B cell receptor signaling pathway
    113253989 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    113253989 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    113253989 (PIK3CB)
   04670 Leukocyte transendothelial migration
    113253989 (PIK3CB)
   04062 Chemokine signaling pathway
    113253989 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113253989 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    113253989 (PIK3CB)
   04929 GnRH secretion
    113253989 (PIK3CB)
   04915 Estrogen signaling pathway
    113253989 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    113253989 (PIK3CB)
   04917 Prolactin signaling pathway
    113253989 (PIK3CB)
   04926 Relaxin signaling pathway
    113253989 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    113253989 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    113253989 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113253989 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113253989 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    113253989 (PIK3CB)
   04722 Neurotrophin signaling pathway
    113253989 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113253989 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    113253989 (PIK3CB)
   04380 Osteoclast differentiation
    113253989 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    113253989 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    113253989 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113253989 (PIK3CB)
   05206 MicroRNAs in cancer
    113253989 (PIK3CB)
   05205 Proteoglycans in cancer
    113253989 (PIK3CB)
   05203 Viral carcinogenesis
    113253989 (PIK3CB)
   05230 Central carbon metabolism in cancer
    113253989 (PIK3CB)
   05231 Choline metabolism in cancer
    113253989 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113253989 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113253989 (PIK3CB)
   05212 Pancreatic cancer
    113253989 (PIK3CB)
   05225 Hepatocellular carcinoma
    113253989 (PIK3CB)
   05226 Gastric cancer
    113253989 (PIK3CB)
   05214 Glioma
    113253989 (PIK3CB)
   05221 Acute myeloid leukemia
    113253989 (PIK3CB)
   05220 Chronic myeloid leukemia
    113253989 (PIK3CB)
   05218 Melanoma
    113253989 (PIK3CB)
   05211 Renal cell carcinoma
    113253989 (PIK3CB)
   05215 Prostate cancer
    113253989 (PIK3CB)
   05213 Endometrial cancer
    113253989 (PIK3CB)
   05224 Breast cancer
    113253989 (PIK3CB)
   05222 Small cell lung cancer
    113253989 (PIK3CB)
   05223 Non-small cell lung cancer
    113253989 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113253989 (PIK3CB)
   05017 Spinocerebellar ataxia
    113253989 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113253989 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113253989 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113253989 (PIK3CB)
   04931 Insulin resistance
    113253989 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113253989 (PIK3CB)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113253989 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    113253989 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113253989 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    113253989 (PIK3CB)
   05162 Measles
    113253989 (PIK3CB)
   05164 Influenza A
    113253989 (PIK3CB)
   05161 Hepatitis B
    113253989 (PIK3CB)
   05160 Hepatitis C
    113253989 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    113253989 (PIK3CB)
   05163 Human cytomegalovirus infection
    113253989 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113253989 (PIK3CB)
   05169 Epstein-Barr virus infection
    113253989 (PIK3CB)
   05165 Human papillomavirus infection
    113253989 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113253989 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    113253989 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113253989 (PIK3CB)
   01524 Platinum drug resistance
    113253989 (PIK3CB)
   01522 Endocrine resistance
    113253989 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113253989 (PIK3CB)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     113253989 (PIK3CB)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113253989 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 113253989
NCBI-ProteinID: XP_026352917
UniProt: A0A3Q7WR04
LinkDB
Position
Unknown
AA seq 1070 aa
MCFNFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSVLENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggctgtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcacaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccctttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcccgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatc
cagtcgcttgtgggattgtcttggatggattggctaaagcagacgtatccaccagaacat
gaaccatcagtccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccagaaacgtttgactattcatgggaaagaagatgaa
gttagtccctatgactatgtgttgcaagtcagtgggagagtagaatacgtgtttggtgat
cacccactcattcagttccagtatatccggaactgtgtaatgaacaggaccttgccccat
tttatgcttgtggaatgttgcaagatcaagaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatcaaaccttcctcttcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtattggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctctgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccgctggaatttgatataaatacttgtgacctgccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtgaaaacgaaaaagtcgactaaaactatt
aatccctctaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcatgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttacatatcaaattcccagagaataaaaaa
caaccttactattatcctcccttcgataagataatcgagaaggcagctgagattgcaagc
agtgacagtgctaatgtatccagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcagttgtgtgagaatgaaatggatcttatttggact
ttgcgacaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccttagagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcactggctaatcggaggatagggcaatttctattttggcaccttaggtca
gaagtgcatattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagcgtagggcacatgaaagtgctttctaagcaggttgaagccctcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagctaaacagagccaaagggaaggag
gccatgcatacttgtttaaagcagaacgcttaccgggaagccctatcggacctgcagtcg
cctctgaatccgtgtgttatcctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctcgtgtacaataacaaagtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaacgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctagaccgagccattgaggag
tttaccttgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
catagtgacaacatcatggtcaaaaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgggtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagagaagtttggc
cgcttccgccagtgttgtgaggatgcatatctgattctacgacggcacgggaatctcttc
atcactctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtaaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Ursus arctos horribilis: 113254730
Entry
113254730         CDS       T05909                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113254730 (PIK3R3)
   04015 Rap1 signaling pathway
    113254730 (PIK3R3)
   04012 ErbB signaling pathway
    113254730 (PIK3R3)
   04370 VEGF signaling pathway
    113254730 (PIK3R3)
   04630 Jak-STAT signaling pathway
    113254730 (PIK3R3)
   04668 TNF signaling pathway
    113254730 (PIK3R3)
   04066 HIF-1 signaling pathway
    113254730 (PIK3R3)
   04068 FoxO signaling pathway
    113254730 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    113254730 (PIK3R3)
   04072 Phospholipase D signaling pathway
    113254730 (PIK3R3)
   04071 Sphingolipid signaling pathway
    113254730 (PIK3R3)
   04024 cAMP signaling pathway
    113254730 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    113254730 (PIK3R3)
   04152 AMPK signaling pathway
    113254730 (PIK3R3)
   04150 mTOR signaling pathway
    113254730 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113254730 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    113254730 (PIK3R3)
   04218 Cellular senescence
    113254730 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113254730 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    113254730 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113254730 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113254730 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    113254730 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    113254730 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    113254730 (PIK3R3)
   04660 T cell receptor signaling pathway
    113254730 (PIK3R3)
   04662 B cell receptor signaling pathway
    113254730 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    113254730 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    113254730 (PIK3R3)
   04670 Leukocyte transendothelial migration
    113254730 (PIK3R3)
   04062 Chemokine signaling pathway
    113254730 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113254730 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    113254730 (PIK3R3)
   04929 GnRH secretion
    113254730 (PIK3R3)
   04915 Estrogen signaling pathway
    113254730 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    113254730 (PIK3R3)
   04917 Prolactin signaling pathway
    113254730 (PIK3R3)
   04926 Relaxin signaling pathway
    113254730 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    113254730 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    113254730 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113254730 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113254730 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    113254730 (PIK3R3)
   04722 Neurotrophin signaling pathway
    113254730 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113254730 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    113254730 (PIK3R3)
   04380 Osteoclast differentiation
    113254730 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    113254730 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    113254730 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254730 (PIK3R3)
   05206 MicroRNAs in cancer
    113254730 (PIK3R3)
   05205 Proteoglycans in cancer
    113254730 (PIK3R3)
   05203 Viral carcinogenesis
    113254730 (PIK3R3)
   05230 Central carbon metabolism in cancer
    113254730 (PIK3R3)
   05231 Choline metabolism in cancer
    113254730 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113254730 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113254730 (PIK3R3)
   05212 Pancreatic cancer
    113254730 (PIK3R3)
   05225 Hepatocellular carcinoma
    113254730 (PIK3R3)
   05226 Gastric cancer
    113254730 (PIK3R3)
   05214 Glioma
    113254730 (PIK3R3)
   05221 Acute myeloid leukemia
    113254730 (PIK3R3)
   05220 Chronic myeloid leukemia
    113254730 (PIK3R3)
   05218 Melanoma
    113254730 (PIK3R3)
   05211 Renal cell carcinoma
    113254730 (PIK3R3)
   05215 Prostate cancer
    113254730 (PIK3R3)
   05213 Endometrial cancer
    113254730 (PIK3R3)
   05224 Breast cancer
    113254730 (PIK3R3)
   05222 Small cell lung cancer
    113254730 (PIK3R3)
   05223 Non-small cell lung cancer
    113254730 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113254730 (PIK3R3)
   05017 Spinocerebellar ataxia
    113254730 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113254730 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113254730 (PIK3R3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113254730 (PIK3R3)
   04931 Insulin resistance
    113254730 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113254730 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113254730 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    113254730 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113254730 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    113254730 (PIK3R3)
   05162 Measles
    113254730 (PIK3R3)
   05164 Influenza A
    113254730 (PIK3R3)
   05161 Hepatitis B
    113254730 (PIK3R3)
   05160 Hepatitis C
    113254730 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    113254730 (PIK3R3)
   05163 Human cytomegalovirus infection
    113254730 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113254730 (PIK3R3)
   05169 Epstein-Barr virus infection
    113254730 (PIK3R3)
   05165 Human papillomavirus infection
    113254730 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113254730 (PIK3R3)
   05142 Chagas disease (American trypanosomiasis)
    113254730 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113254730 (PIK3R3)
   01524 Platinum drug resistance
    113254730 (PIK3R3)
   01522 Endocrine resistance
    113254730 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113254730 (PIK3R3)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113254730 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 PI_PP_I DUF5638 Exonuc_VII_L
Other DBs
NCBI-GeneID: 113254730
NCBI-ProteinID: XP_026353975
UniProt: A0A3Q7VP33
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEEADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaagtaaatgacaaattacgg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggggattac
actttgactttgaggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgagtctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagacaacattgacgcagttggtaaaaaa
ctgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatatgag
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcaatgtcacacacaggaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaacgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagcatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggaggctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggag
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctcactgaaggagctggtgctgcattaccagcagacatccctcgttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataa

KEGG   Ursus arctos horribilis: 113254799
Entry
113254799         CDS       T05909                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113254799 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113254799 (PIK3CA)
   04015 Rap1 signaling pathway
    113254799 (PIK3CA)
   04012 ErbB signaling pathway
    113254799 (PIK3CA)
   04370 VEGF signaling pathway
    113254799 (PIK3CA)
   04630 Jak-STAT signaling pathway
    113254799 (PIK3CA)
   04668 TNF signaling pathway
    113254799 (PIK3CA)
   04066 HIF-1 signaling pathway
    113254799 (PIK3CA)
   04068 FoxO signaling pathway
    113254799 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    113254799 (PIK3CA)
   04072 Phospholipase D signaling pathway
    113254799 (PIK3CA)
   04071 Sphingolipid signaling pathway
    113254799 (PIK3CA)
   04024 cAMP signaling pathway
    113254799 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    113254799 (PIK3CA)
   04152 AMPK signaling pathway
    113254799 (PIK3CA)
   04150 mTOR signaling pathway
    113254799 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113254799 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    113254799 (PIK3CA)
   04218 Cellular senescence
    113254799 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113254799 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    113254799 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113254799 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113254799 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    113254799 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    113254799 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    113254799 (PIK3CA)
   04660 T cell receptor signaling pathway
    113254799 (PIK3CA)
   04662 B cell receptor signaling pathway
    113254799 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    113254799 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    113254799 (PIK3CA)
   04670 Leukocyte transendothelial migration
    113254799 (PIK3CA)
   04062 Chemokine signaling pathway
    113254799 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113254799 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    113254799 (PIK3CA)
   04929 GnRH secretion
    113254799 (PIK3CA)
   04915 Estrogen signaling pathway
    113254799 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    113254799 (PIK3CA)
   04917 Prolactin signaling pathway
    113254799 (PIK3CA)
   04926 Relaxin signaling pathway
    113254799 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    113254799 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    113254799 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113254799 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113254799 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    113254799 (PIK3CA)
   04722 Neurotrophin signaling pathway
    113254799 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113254799 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    113254799 (PIK3CA)
   04380 Osteoclast differentiation
    113254799 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    113254799 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    113254799 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254799 (PIK3CA)
   05206 MicroRNAs in cancer
    113254799 (PIK3CA)
   05205 Proteoglycans in cancer
    113254799 (PIK3CA)
   05203 Viral carcinogenesis
    113254799 (PIK3CA)
   05230 Central carbon metabolism in cancer
    113254799 (PIK3CA)
   05231 Choline metabolism in cancer
    113254799 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113254799 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113254799 (PIK3CA)
   05212 Pancreatic cancer
    113254799 (PIK3CA)
   05225 Hepatocellular carcinoma
    113254799 (PIK3CA)
   05226 Gastric cancer
    113254799 (PIK3CA)
   05214 Glioma
    113254799 (PIK3CA)
   05221 Acute myeloid leukemia
    113254799 (PIK3CA)
   05220 Chronic myeloid leukemia
    113254799 (PIK3CA)
   05218 Melanoma
    113254799 (PIK3CA)
   05211 Renal cell carcinoma
    113254799 (PIK3CA)
   05215 Prostate cancer
    113254799 (PIK3CA)
   05213 Endometrial cancer
    113254799 (PIK3CA)
   05224 Breast cancer
    113254799 (PIK3CA)
   05222 Small cell lung cancer
    113254799 (PIK3CA)
   05223 Non-small cell lung cancer
    113254799 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113254799 (PIK3CA)
   05017 Spinocerebellar ataxia
    113254799 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113254799 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113254799 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113254799 (PIK3CA)
   04931 Insulin resistance
    113254799 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113254799 (PIK3CA)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113254799 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    113254799 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113254799 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    113254799 (PIK3CA)
   05162 Measles
    113254799 (PIK3CA)
   05164 Influenza A
    113254799 (PIK3CA)
   05161 Hepatitis B
    113254799 (PIK3CA)
   05160 Hepatitis C
    113254799 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    113254799 (PIK3CA)
   05163 Human cytomegalovirus infection
    113254799 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113254799 (PIK3CA)
   05169 Epstein-Barr virus infection
    113254799 (PIK3CA)
   05165 Human papillomavirus infection
    113254799 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113254799 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    113254799 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113254799 (PIK3CA)
   01524 Platinum drug resistance
    113254799 (PIK3CA)
   01522 Endocrine resistance
    113254799 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113254799 (PIK3CA)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     113254799 (PIK3CA)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113254799 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 113254799
NCBI-ProteinID: XP_026354115
UniProt: A0A3Q7VPI0
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acactaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcctcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtgatagtgtctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactagaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaataccctctaagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccttcatattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattagagacattgacaagatctatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctaaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactttagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttgactggttc
agcagtgtggtcaagttcccagatatgtcagtgattgaagagcatgccaactggtcggtg
tctcgggaagcaggatttagttattcccatgcaggactgagtaacagattagctagagac
aacgagttaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaacc
atccctgaaattctacccaaattgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgtaattacccagatcccatggttcgaggttttgctgtccggtgcttggaa
aaatacttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacggtg
agtcagcggtttggcctccttttggagtcctattgtcgtgcatgcgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctttacaaggttttctgtctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttatcgaggtggtgcgaaactcgcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggcgctctgcagttcaacagccacacactccaccagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctactttcatactgggcattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacaccatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Ursus arctos horribilis: 113255266
Entry
113255266         CDS       T05909                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255266 (PIK3R1)
   04015 Rap1 signaling pathway
    113255266 (PIK3R1)
   04012 ErbB signaling pathway
    113255266 (PIK3R1)
   04370 VEGF signaling pathway
    113255266 (PIK3R1)
   04630 Jak-STAT signaling pathway
    113255266 (PIK3R1)
   04668 TNF signaling pathway
    113255266 (PIK3R1)
   04066 HIF-1 signaling pathway
    113255266 (PIK3R1)
   04068 FoxO signaling pathway
    113255266 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    113255266 (PIK3R1)
   04072 Phospholipase D signaling pathway
    113255266 (PIK3R1)
   04071 Sphingolipid signaling pathway
    113255266 (PIK3R1)
   04024 cAMP signaling pathway
    113255266 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    113255266 (PIK3R1)
   04152 AMPK signaling pathway
    113255266 (PIK3R1)
   04150 mTOR signaling pathway
    113255266 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113255266 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    113255266 (PIK3R1)
   04218 Cellular senescence
    113255266 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113255266 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113255266 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255266 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113255266 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    113255266 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    113255266 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    113255266 (PIK3R1)
   04660 T cell receptor signaling pathway
    113255266 (PIK3R1)
   04662 B cell receptor signaling pathway
    113255266 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    113255266 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    113255266 (PIK3R1)
   04670 Leukocyte transendothelial migration
    113255266 (PIK3R1)
   04062 Chemokine signaling pathway
    113255266 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113255266 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    113255266 (PIK3R1)
   04929 GnRH secretion
    113255266 (PIK3R1)
   04915 Estrogen signaling pathway
    113255266 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    113255266 (PIK3R1)
   04917 Prolactin signaling pathway
    113255266 (PIK3R1)
   04926 Relaxin signaling pathway
    113255266 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    113255266 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    113255266 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113255266 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113255266 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    113255266 (PIK3R1)
   04722 Neurotrophin signaling pathway
    113255266 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113255266 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    113255266 (PIK3R1)
   04380 Osteoclast differentiation
    113255266 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    113255266 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    113255266 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255266 (PIK3R1)
   05206 MicroRNAs in cancer
    113255266 (PIK3R1)
   05205 Proteoglycans in cancer
    113255266 (PIK3R1)
   05203 Viral carcinogenesis
    113255266 (PIK3R1)
   05230 Central carbon metabolism in cancer
    113255266 (PIK3R1)
   05231 Choline metabolism in cancer
    113255266 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113255266 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113255266 (PIK3R1)
   05212 Pancreatic cancer
    113255266 (PIK3R1)
   05225 Hepatocellular carcinoma
    113255266 (PIK3R1)
   05226 Gastric cancer
    113255266 (PIK3R1)
   05214 Glioma
    113255266 (PIK3R1)
   05221 Acute myeloid leukemia
    113255266 (PIK3R1)
   05220 Chronic myeloid leukemia
    113255266 (PIK3R1)
   05218 Melanoma
    113255266 (PIK3R1)
   05211 Renal cell carcinoma
    113255266 (PIK3R1)
   05215 Prostate cancer
    113255266 (PIK3R1)
   05213 Endometrial cancer
    113255266 (PIK3R1)
   05224 Breast cancer
    113255266 (PIK3R1)
   05222 Small cell lung cancer
    113255266 (PIK3R1)
   05223 Non-small cell lung cancer
    113255266 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113255266 (PIK3R1)
   05017 Spinocerebellar ataxia
    113255266 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113255266 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113255266 (PIK3R1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113255266 (PIK3R1)
   04931 Insulin resistance
    113255266 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113255266 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113255266 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    113255266 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113255266 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    113255266 (PIK3R1)
   05162 Measles
    113255266 (PIK3R1)
   05164 Influenza A
    113255266 (PIK3R1)
   05161 Hepatitis B
    113255266 (PIK3R1)
   05160 Hepatitis C
    113255266 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    113255266 (PIK3R1)
   05163 Human cytomegalovirus infection
    113255266 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113255266 (PIK3R1)
   05169 Epstein-Barr virus infection
    113255266 (PIK3R1)
   05165 Human papillomavirus infection
    113255266 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113255266 (PIK3R1)
   05142 Chagas disease (American trypanosomiasis)
    113255266 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113255266 (PIK3R1)
   01524 Platinum drug resistance
    113255266 (PIK3R1)
   01522 Endocrine resistance
    113255266 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113255266 (PIK3R1)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113255266 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 DUF4201 Laminin_I Mod_r Lant_dehydr_C PI_PP_I
Other DBs
NCBI-GeneID: 113255266
NCBI-ProteinID: XP_026354645
UniProt: A0A3Q7VQZ0
LinkDB
Position
Unknown
AA seq 725 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADGEQQQALALPDLA
EQFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDV
QVLGDAFKRYLLDLPNPVIPVAVYSEMIYLAQEVQSSEEYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLSQASSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNAQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgagcgctgtatgattacaaaaaggaacgagaagaa
gatattgacttgcacttgggtgatatcttgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggttataat
gaaaccaccggggaaagaggggactttccgggaacttatgttgaatatatcggaaggaaa
aaaatctctcctcccacaccaaagccccgaccacctcgaccccttcctgttgcaccaggt
tcttcgaaagctgaagcagacggtgaacaacagcaagctttggcccttccagatcttgca
gagcagtttgcccctcccgacattgctccgcctcttcttgtgaagctagtggaagccatt
gaaaagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagca
gaattacgacagcttcttgattgtgatgccgcctccgtggacttggaaatgatcgatgtg
caagttttaggagacgctttcaaacgctatcttttggacttaccgaatcctgtcattcca
gtggccgtttacagtgaaatgatttatttagcccaagaagtacaaagctctgaagagtat
atccagctgttgaagaagctcattagggcacctaacatacctcatcagtattggcttacg
cttcagtatttgctaaaacatttcttcaagctctctcaagcctccagcaagaatcttctg
aatgcaagagtactctctgaacttttcagtcctctgcttttcagattcccagcagccagc
tctgagaatactgaacacctcataaaagttatagaaattttaatctcaactgagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccacccaaacccactactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctca
agggaagaagtgaatgagaaacttcgagacacagctgacgggacctttttggtacgagac
gcatctaccaaaatgcatggtgactatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccactgaccttcaac
tctgtggttgaactaataaaccactaccggaacgagtctctagctcagtataaccccaaa
ctggacgtgaaattactttatccggtatccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtaggaaaaaaattacatgaatataatgctcaatttcaagaaaaa
agtcgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
agccaggaacggtacagcaaagaatacatagaaaaatttaaacgtgaaggcaatgagaaa
gaaatacaaaggattatgcataattatgagaagctaaagtcccgaatcagtgaaatcgtg
gacagcagacgacgactggaggaagacttgaagaagcaggcggctgagtaccgggagatt
gacaaacgcatgaacagcataaagccggacctcatccagctgagaaagacgagagaccaa
tacttgatgtggctgactcagaagggcgtccggcagaagaagctcaatgagtggctgggc
aacgagaacacggaggaccaatactcgctggtggaagatgatgaggatttgccgcaccac
gacgagaagacctggaacgtgggcagcagcaaccgcaacaaagcggagaacctactccga
gggaaacgagacggcaccttcctggtccgggagagcagtaaacagggctgctacgcctgc
tctgtcgtggtggacggcgaagtcaagcattgcgtcatcaacaaaacggccaccggctat
ggcttcgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaa
cacacctccctcgtgcagcacaatgactcgctcaacgtcacactagcctacccggtatat
gcacagcagaggcgatga

KEGG   Ursus arctos horribilis: 113256705
Entry
113256705         CDS       T05909                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113256705 (PIK3R2)
   04015 Rap1 signaling pathway
    113256705 (PIK3R2)
   04012 ErbB signaling pathway
    113256705 (PIK3R2)
   04370 VEGF signaling pathway
    113256705 (PIK3R2)
   04630 Jak-STAT signaling pathway
    113256705 (PIK3R2)
   04668 TNF signaling pathway
    113256705 (PIK3R2)
   04066 HIF-1 signaling pathway
    113256705 (PIK3R2)
   04068 FoxO signaling pathway
    113256705 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    113256705 (PIK3R2)
   04072 Phospholipase D signaling pathway
    113256705 (PIK3R2)
   04071 Sphingolipid signaling pathway
    113256705 (PIK3R2)
   04024 cAMP signaling pathway
    113256705 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    113256705 (PIK3R2)
   04152 AMPK signaling pathway
    113256705 (PIK3R2)
   04150 mTOR signaling pathway
    113256705 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113256705 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    113256705 (PIK3R2)
   04218 Cellular senescence
    113256705 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113256705 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    113256705 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113256705 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113256705 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    113256705 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    113256705 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    113256705 (PIK3R2)
   04660 T cell receptor signaling pathway
    113256705 (PIK3R2)
   04662 B cell receptor signaling pathway
    113256705 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    113256705 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    113256705 (PIK3R2)
   04670 Leukocyte transendothelial migration
    113256705 (PIK3R2)
   04062 Chemokine signaling pathway
    113256705 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113256705 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    113256705 (PIK3R2)
   04929 GnRH secretion
    113256705 (PIK3R2)
   04915 Estrogen signaling pathway
    113256705 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    113256705 (PIK3R2)
   04917 Prolactin signaling pathway
    113256705 (PIK3R2)
   04926 Relaxin signaling pathway
    113256705 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    113256705 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    113256705 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113256705 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113256705 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    113256705 (PIK3R2)
   04722 Neurotrophin signaling pathway
    113256705 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113256705 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    113256705 (PIK3R2)
   04380 Osteoclast differentiation
    113256705 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    113256705 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    113256705 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256705 (PIK3R2)
   05206 MicroRNAs in cancer
    113256705 (PIK3R2)
   05205 Proteoglycans in cancer
    113256705 (PIK3R2)
   05203 Viral carcinogenesis
    113256705 (PIK3R2)
   05230 Central carbon metabolism in cancer
    113256705 (PIK3R2)
   05231 Choline metabolism in cancer
    113256705 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113256705 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113256705 (PIK3R2)
   05212 Pancreatic cancer
    113256705 (PIK3R2)
   05225 Hepatocellular carcinoma
    113256705 (PIK3R2)
   05226 Gastric cancer
    113256705 (PIK3R2)
   05214 Glioma
    113256705 (PIK3R2)
   05221 Acute myeloid leukemia
    113256705 (PIK3R2)
   05220 Chronic myeloid leukemia
    113256705 (PIK3R2)
   05218 Melanoma
    113256705 (PIK3R2)
   05211 Renal cell carcinoma
    113256705 (PIK3R2)
   05215 Prostate cancer
    113256705 (PIK3R2)
   05213 Endometrial cancer
    113256705 (PIK3R2)
   05224 Breast cancer
    113256705 (PIK3R2)
   05222 Small cell lung cancer
    113256705 (PIK3R2)
   05223 Non-small cell lung cancer
    113256705 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113256705 (PIK3R2)
   05017 Spinocerebellar ataxia
    113256705 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113256705 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113256705 (PIK3R2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113256705 (PIK3R2)
   04931 Insulin resistance
    113256705 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113256705 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113256705 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    113256705 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113256705 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    113256705 (PIK3R2)
   05162 Measles
    113256705 (PIK3R2)
   05164 Influenza A
    113256705 (PIK3R2)
   05161 Hepatitis B
    113256705 (PIK3R2)
   05160 Hepatitis C
    113256705 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    113256705 (PIK3R2)
   05163 Human cytomegalovirus infection
    113256705 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113256705 (PIK3R2)
   05169 Epstein-Barr virus infection
    113256705 (PIK3R2)
   05165 Human papillomavirus infection
    113256705 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113256705 (PIK3R2)
   05142 Chagas disease (American trypanosomiasis)
    113256705 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113256705 (PIK3R2)
   01524 Platinum drug resistance
    113256705 (PIK3R2)
   01522 Endocrine resistance
    113256705 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113256705 (PIK3R2)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113256705 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 113256705
NCBI-ProteinID: XP_026356308
UniProt: A0A3Q7W4V6
LinkDB
Position
Unknown
AA seq 726 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSESLYRPERPAPRTDWSLSDVEQWDAAALTDGVKGFLLA
LPAPLVTPEAAAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRLARRAPAPG
PAVRALGATFGPLLLRAPPPSPPPGGAPDGTESSPDFPVLLVEKLLQEHLEEQEVAPPAL
PPKPPKAKPAPAGLANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPG
PPPAAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggccggtgctgagggcttccagtaccgtgcactgtacccattccgccgggagcggcca
gaggacctggagctgctgccaggcgacgtgctggtggtgagccgggcagccctgcaggtg
ctgggcgtggctgagggcaacgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgagcgcacgcggcaacgaggcgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcctggccctcgtccacgtggcccccgcccactgcccgccaggccc
cgggatgggccccctgagccaggcctcacactccccgacctgccagagcagttctcccca
cctgatgtggctccccccatcctggtgaagctggtggaggccattgagcggacagggcta
gacagcgaatccctctacaggcctgagcggccagccccgcgcacagactggtccctgagc
gacgtggagcagtgggatgccgcagccctgacagacggcgtcaagggcttcctgctggcg
ctgcccgcacccctcgtgacgcccgaggccgcggccgaggcgcgccgggccctgcgggag
gccgcggggccggtggggccggcgctggagcccccgacgctgccactgcaccgcgcgctc
acgctgcgcttcttgctccagcacctgggccggctggcccggcgcgcccccgctccgggt
cccgccgtgcgagccctgggcgccaccttcgggccgctgctgctgcgcgcgccgcctccc
tcgccgccgccagggggcgcgcccgacgggactgagtccagccctgacttcccggtgctg
ctggtggagaagttgcttcaggaacatctggaggagcaggaggtcgcacccccagctctg
ccgcctaaaccccccaaggcaaagcctgcccctgcaggcctggccaatggggggaatcca
ccctccctgcaggacgctgagtggtactggggtgacatttccagggaggaggtgaacgag
aagctccgggacacgcctgatggcacctttctggtccgagatgcatctagcaagatccag
ggggagtacacactgaccctcaggaaaggcgggaacaacaagctgattaaagtcttccac
cgcgacgggcactatggcttctcagagccactcaccttctgctccgttgtggacctcatc
acccactaccgccatgagtcactggcccagtacaatgccaagctggacacccggctcctc
taccccgtgtccaagtaccagcaggaccagatcgtcaaggaggacagcgtggaggcggtg
ggtgcccagctcaaagtctaccaccagcagtaccaggacaagagccgcgagtatgaccag
ctctatgaggagtacacccgcacctcccaggaactgcagatgaagcgcacggcaattgag
gccttcaatgagaccatcaagatctttgaagagcagggccagacgcaagagaagtgtagc
aaggaatacctggagcgcttccgacgtgagggtaatgagaaagagatgcagaggatcctg
ctgaactcagagcggctcaagtctcgcatcgctgaaatccatgagagccgcacaaagctg
gagcaggagctgcgggcacaggcctcagacaaccgggagatcgacaagcgcatgaacagc
ctcaagccagatctcatgcagctgcgcaagatccgagaccagtacctcgtgtggcttacc
cagaaaggcgcccggcagaagaagatcaacgagtggctggggatcaaaaatgagactgag
gaccagtacgcgctgatggaggatgaggatgacctcccccaccatgaggaacgcacgtgg
tatgtgggcaagatcaaccgaacacaggctgaggaaatgctgagtggcaagcgggatggt
accttcctcatccgggagagcagccagcggggctgctacgcctgctctgtggtggtggac
ggcgacacgaagcactgcgtcatctaccgcacggccacgggcttcggcttcgcggagccc
tacaacctgtacgggtcgctgaaggagctcgtgctgcattaccagcacgcctcgctcgtg
cagcacaacgacgcgctcacggtcacgctcgcccacccagtgcgcgcccccggccccggc
cccccgccagctgcgcgttga

KEGG   Ursus arctos horribilis: 113270537
Entry
113270537         CDS       T05909                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05100  Bacterial invasion of epithelial cells
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05146  Amoebiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113270537 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113270537 (PIK3CD)
   04015 Rap1 signaling pathway
    113270537 (PIK3CD)
   04012 ErbB signaling pathway
    113270537 (PIK3CD)
   04370 VEGF signaling pathway
    113270537 (PIK3CD)
   04630 Jak-STAT signaling pathway
    113270537 (PIK3CD)
   04668 TNF signaling pathway
    113270537 (PIK3CD)
   04066 HIF-1 signaling pathway
    113270537 (PIK3CD)
   04068 FoxO signaling pathway
    113270537 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    113270537 (PIK3CD)
   04072 Phospholipase D signaling pathway
    113270537 (PIK3CD)
   04071 Sphingolipid signaling pathway
    113270537 (PIK3CD)
   04024 cAMP signaling pathway
    113270537 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    113270537 (PIK3CD)
   04152 AMPK signaling pathway
    113270537 (PIK3CD)
   04150 mTOR signaling pathway
    113270537 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113270537 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    113270537 (PIK3CD)
   04218 Cellular senescence
    113270537 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113270537 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    113270537 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113270537 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113270537 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    113270537 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    113270537 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    113270537 (PIK3CD)
   04660 T cell receptor signaling pathway
    113270537 (PIK3CD)
   04662 B cell receptor signaling pathway
    113270537 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    113270537 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    113270537 (PIK3CD)
   04670 Leukocyte transendothelial migration
    113270537 (PIK3CD)
   04062 Chemokine signaling pathway
    113270537 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113270537 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    113270537 (PIK3CD)
   04929 GnRH secretion
    113270537 (PIK3CD)
   04915 Estrogen signaling pathway
    113270537 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    113270537 (PIK3CD)
   04917 Prolactin signaling pathway
    113270537 (PIK3CD)
   04926 Relaxin signaling pathway
    113270537 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    113270537 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    113270537 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113270537 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113270537 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    113270537 (PIK3CD)
   04722 Neurotrophin signaling pathway
    113270537 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113270537 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    113270537 (PIK3CD)
   04380 Osteoclast differentiation
    113270537 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    113270537 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    113270537 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270537 (PIK3CD)
   05206 MicroRNAs in cancer
    113270537 (PIK3CD)
   05205 Proteoglycans in cancer
    113270537 (PIK3CD)
   05203 Viral carcinogenesis
    113270537 (PIK3CD)
   05230 Central carbon metabolism in cancer
    113270537 (PIK3CD)
   05231 Choline metabolism in cancer
    113270537 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113270537 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113270537 (PIK3CD)
   05212 Pancreatic cancer
    113270537 (PIK3CD)
   05225 Hepatocellular carcinoma
    113270537 (PIK3CD)
   05226 Gastric cancer
    113270537 (PIK3CD)
   05214 Glioma
    113270537 (PIK3CD)
   05221 Acute myeloid leukemia
    113270537 (PIK3CD)
   05220 Chronic myeloid leukemia
    113270537 (PIK3CD)
   05218 Melanoma
    113270537 (PIK3CD)
   05211 Renal cell carcinoma
    113270537 (PIK3CD)
   05215 Prostate cancer
    113270537 (PIK3CD)
   05213 Endometrial cancer
    113270537 (PIK3CD)
   05224 Breast cancer
    113270537 (PIK3CD)
   05222 Small cell lung cancer
    113270537 (PIK3CD)
   05223 Non-small cell lung cancer
    113270537 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113270537 (PIK3CD)
   05017 Spinocerebellar ataxia
    113270537 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113270537 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113270537 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113270537 (PIK3CD)
   04931 Insulin resistance
    113270537 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113270537 (PIK3CD)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113270537 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    113270537 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113270537 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    113270537 (PIK3CD)
   05162 Measles
    113270537 (PIK3CD)
   05164 Influenza A
    113270537 (PIK3CD)
   05161 Hepatitis B
    113270537 (PIK3CD)
   05160 Hepatitis C
    113270537 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    113270537 (PIK3CD)
   05163 Human cytomegalovirus infection
    113270537 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270537 (PIK3CD)
   05169 Epstein-Barr virus infection
    113270537 (PIK3CD)
   05165 Human papillomavirus infection
    113270537 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113270537 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    113270537 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113270537 (PIK3CD)
   01524 Platinum drug resistance
    113270537 (PIK3CD)
   01522 Endocrine resistance
    113270537 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113270537 (PIK3CD)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     113270537 (PIK3CD)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    113270537 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 113270537
NCBI-ProteinID: XP_026375671
UniProt: A0A3Q7WS31
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRQEYLYGGYPLCQFQYICGCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLGSWPELPVLSALELLDCSFPDRHVGSFAIKSL
RKLTDDELFRYLLQLVQVLKYESYLDCELAKFLLARALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHVCMR
QETYLEALSNVQSPLDPSTLLAEVCVEQCTFMDSKMKPLWLVYSSEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gccgttgacttcctgttgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgggcccagtatgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagacggccgagcagcaa
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgccggtgctgcgg
ctggtggcccgagagggcgacagggtgaagaagctggtcaattctcagatcagcctcctc
atcggcaaaggcctccacgagttcgactccctgcatgacccagaagtgaacgcctttcgc
accaagatgcgccagttctgtgaggaggcggccgcccggcggcagcagctgggctgggag
gcttggctacagtacagcttcccactgcagctggagccctcggcgcggagctggggggcc
ggcaccctgcgggtccccaaccgggccctcctggtcaacgtcaagttcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccactggcgctgatggcgtgcgcg
ctgcggaagaaggccaccgtgttccggcagcccctggtggaacagcccgaggactacacg
ctgcaggtgaacgggaggcaggagtacctgtacggcggctacccgctctgccagttccag
tacatatgcggctgcctgcacagcgggctgaccccccacctgaccatggtgcactcgtcc
tccatccttgccatgcgggacgagcagagcgaccctgccccccaagtccagaaaccgcgc
accaaaccaccccccattcccatgaagaagccttcctccttgtccctgtggtccctggag
cagcctttctgcgtggagctgattcagggcagcaaagtgaatgccgatgagcggatgaag
ctggtcgtgcaggcggggctgttccacggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaaacagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccgtccgtcccagacgagaaaggggagctgctgaaccccacggggacagtgcgg
agtaaccccaacacggagagcgctgcggccctcgtcatctgcctccccgaggtggccccc
taccctgtgtactaccccaccctggacaagattctggagctggggcggcatggggagcac
gggcgcttcagcgaggaggagcagctacagctgcgggaaatcctggagcggcgggggtcc
ggcgagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cgctttcccgaggcgctggcccgcctgctgctggtcaccaagtggaacaagcacgaggac
gtggcccagatgctctacctgctgggctcctggcccgagctgcccgtcctgagcgccctg
gagctgctggactgcagcttccccgaccgccacgtgggctccttcgccatcaagtctctg
cggaagttgacggacgacgagctcttccggtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctggccaagttcctgctggcccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtccgtg
gccctgcgcttcggcctcatcatggaggcctactgccggggtagcacccaccacatgaag
gtgctcatgaagcagggggaggcgctgagcaaactgaaggccctgaatgactttgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacgtgtgcatgcgt
caggagacctacctggaggccctttccaacgtgcagtccccgctggaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccttgtgg
ctcgtgtacagcagcgaggaggcgggcagcgacggcagcgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgactctgcagatgatccagctcatggacgttctg
tggaagcaggagggactggacctgaggatgaccccctacggctgcctctccaccggggac
cgcactggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagttgaac
aaaagcaacatggcggccacagctgccttcaacaaggatgccctgctcaactggctcaag
tccaagaaccctggggaggccttggatcgagccatcgaggagtttaccctctcctgtgct
ggctactgtgtggccacttacgtgctgggcatcggagaccggcacagcgacaacatcatg
atccgcgagaacgggcagctcttccacattgatttcggccactttctgggcaatttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacgtatgactttgtgcac
gtgatccagcaggggaaaacgaataacagtgagaaatttgaaaggttccggggttactgt
gagcgagcctacaccatcctgaggcgccacgggctgctctttctccacctcttcgccctg
atgcgggccgccggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggcgttgggaaagacggaggaggaggccctaaagcacttccgagtaaagttcaac
gaagccctccgggagagctggaagaccaaagtgaactggctggcccacaatgtgtccaaa
gataacaggcaatag

DBGET integrated database retrieval system