KEGG   Ursus arctos horribilis: 113254130
Entry
113254130         CDS       T05909                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04620  Toll-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04940  Type I diabetes mellitus
uah05133  Pertussis
uah05134  Legionellosis
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254130 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254130 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113254130 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    113254130 (IL12A)
   04625 C-type lectin receptor signaling pathway
    113254130 (IL12A)
   04658 Th1 and Th2 cell differentiation
    113254130 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254130 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254130 (IL12A)
   05330 Allograft rejection
    113254130 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113254130 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113254130 (IL12A)
   05134 Legionellosis
    113254130 (IL12A)
   05152 Tuberculosis
    113254130 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    113254130 (IL12A)
   05164 Influenza A
    113254130 (IL12A)
   05168 Herpes simplex virus 1 infection
    113254130 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113254130 (IL12A)
   05144 Malaria
    113254130 (IL12A)
   05145 Toxoplasmosis
    113254130 (IL12A)
   05140 Leishmaniasis
    113254130 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    113254130 (IL12A)
   05143 African trypanosomiasis
    113254130 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113254130 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113254130 (IL12A)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113254130 (IL12A)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113254130 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 113254130
NCBI-ProteinID: XP_026353170
UniProt: A0A3Q7VLU3
LinkDB
Position
Unknown
AA seq 222 aa
MCPPRGLLLATVLVLLNHLDHLGLARSLPPASPSPGMFPCLNHSQNLLRAVSNSLQKARQ
TLELYSCTSEEIDHEDMTKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKAS
FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNFNSVTV
PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgccgcgcggcctcctcctcgcgaccgtcctggtcctcctaaaccacctggac
cacctcggtttggccaggagcctccccccagcgtccccaagcccagggatgttcccgtgc
ctcaaccactcccaaaacctgctgagagccgtcagcaactcgcttcagaaggccagacaa
actctagaactttactcctgcacttctgaagagattgatcatgaagacatgacaaaggat
aaaaccagcacagtggaggcctgcttaccgttggaattaaccatgaatgagagttgcctg
gcttccagagagatctctttgataactaatgggagttgcctggcatccagaaaggcctct
tttatgacaaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaacgcaaagctcctaatggatcctaagaggcagatctttctggatcaa
aacatgctgacagctattgatgagctgttacaggccctgaatttcaacagtgtgactgtg
ccacagaaatcctcccttgaagaaccggatttttataaaactaaaatcaagctctgcata
cttcttcacgctttcagaattcgggcggtgaccatcgatagaatgatgagctatctgaat
tcttcctaa

KEGG   Ursus arctos horribilis: 113263879
Entry
113263879         CDS       T05909                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04620  Toll-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04940  Type I diabetes mellitus
uah05133  Pertussis
uah05134  Legionellosis
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113263879 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263879 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263879 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    113263879 (IL12B)
   04625 C-type lectin receptor signaling pathway
    113263879 (IL12B)
   04658 Th1 and Th2 cell differentiation
    113263879 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263879 (IL12B)
   05205 Proteoglycans in cancer
    113263879 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113263879 (IL12B)
   05330 Allograft rejection
    113263879 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113263879 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113263879 (IL12B)
   05134 Legionellosis
    113263879 (IL12B)
   05152 Tuberculosis
    113263879 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    113263879 (IL12B)
   05164 Influenza A
    113263879 (IL12B)
   05168 Herpes simplex virus 1 infection
    113263879 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113263879 (IL12B)
   05145 Toxoplasmosis
    113263879 (IL12B)
   05140 Leishmaniasis
    113263879 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    113263879 (IL12B)
   05143 African trypanosomiasis
    113263879 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263879 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113263879 (IL12B)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113263879 (IL12B)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113263879 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_4 Ig_2 fn3 DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 113263879
NCBI-ProteinID: XP_026366447
UniProt: A0A3Q7XTL8
LinkDB
Position
Unknown
AA seq 329 aa
MQPQQLVVSWFSLVLLASPLMAVWELEKNVYVVELDWHPDAPGEVVVLTCHTPEEDDITW
TSDQSSEVLGSGKTLTVQVKEFGDAGRYTCHKGGKVLSDSLLLIHKKEDGIWSTDILKEQ
KESKNRIFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSADRV
RVDNRDYKKYTVECQEGSACPTAEESLPIEVVVDAIHKLKYENYTRSFFIRDIIKPDPPM
NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCIQGQGKNHREKKERLCVDKTSAKVT
CPREAKIRVQARDRYYSSSWSDWAAVSCT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagccgcagcagctggtcgtctcctggttctccctggttctgttggcatctcccctc
atggccgtatgggaactggagaaaaatgtttatgttgtagagttggactggcacccggac
gcccccggagaggtggtggtcctcacctgccatactcctgaagaggatgacatcacctgg
acctcagaccagagcagtgaagtcttaggctctggtaaaactctgaccgtccaagtcaaa
gaatttggagatgctggccggtatacctgtcataaaggaggcaaggttctgagcgattcg
ctcctgctgattcacaaaaaggaagatggaatctggtccactgatatcttaaaggaacag
aaagaatccaaaaataggatctttctaaaatgtgaggcaaagaattattctggacatttc
acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaaaagcagcaga
ggcttctctgacccccaaggggtgacgtgtggagcagtgacactctcagcagacagggtc
agagtggacaacagggattataagaagtacacggtggagtgtcaggagggcagcgcctgc
cccacagccgaggagagcctacccatcgaggtcgtggtggacgctattcacaagctcaag
tatgaaaactacaccaggagcttcttcatcagggacatcatcaaaccggacccgcccatg
aacctgcagctgaagcccttaaaaaattctcggcatgtggaggtcagctgggaatacccc
gacacttggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc
aagaaccatcgggaaaagaaagagagactctgcgtggacaagacctcggccaaggtcacg
tgccccagggaggccaagatccgcgtgcaagcccgagaccgctactacagctcatcctgg
agcgattgggcagctgtgtcctgcacttag

DBGET integrated database retrieval system