KEGG   Ursus arctos horribilis: 113254551
Entry
113254551         CDS       T05909                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254551 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254551 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113254551 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254551 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254551 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254551 (IL12RB2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113254551 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 113254551
NCBI-ProteinID: XP_026353632
UniProt: A0A3Q7WT32
LinkDB
Position
Unknown
AA seq 862 aa
MAHTVGGCSLALIFIIVLLLVKANIDACKRGDVTVEPSHVISLGSAVNISCSLKPEQGCP
QYSSLNRLILYKVNEKINLLHGHFLSSQVTDLPLGTTVFFCKLACSKKKELRICGAEISV
GVVPEQPQNLSCIQKGERGTVNCTWDRGRDTHLYTTYTLQLNGPKNLTWQKQCNGHYCDH
LDLGVNLIPELPESSYTAKVTATNRLGNASSFPSTFTFWDIVRPLPPCDIRIKCVNASVS
RCILQWSDEGLVLLNRLRYRPNSSWSWKMVSATNVKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRTQTPEEEPTGTLDVWYMKQHIDYSRQQISLFWKNMSLSEARGKILHY
RVTLQEVAGGKVTLQNITEHTSWTWVIPRTGNWVVTVSAANSKGSSLPTRINITDLLGPG
LPAPRQVSANSKGGDNIMVTWEPPGKAAPAVQEYVVEWRELHPRGGTQPPLNWLRTTPYN
VSALISENIKPYSCYEISVYALSGDQRGGSSIRANSKHKAPLSGPHINAISEEKGSVLIS
WNEVPAQEQMGCLLHYRIYWKEQDSNSQPQLCEIPYRVSLNSHSIDSLQPRVTYVLWMTA
LTAAGESPPGNKREFCLEGKASWSVFVAPSICIAVVIVGIFSMRYFRQKVFVLLSALRPQ
WCSKEIPDPANSTWAKKYPIVEEKTQLPLDRLLTDWPNPEEPETLVITEVLHQVTPVFRH
PCHPNWPDKGQGVQGHYTSEEDTGYSASSLPPSKALIAETGQLVDLYKMLGSRGPDSKPG
HLVSPLTALPVDYLPTHEGYLPANIEYLPSHEVPVTDPLEELEPQHISLSVFPSSSLHPL
TFSCDKKLTLDRLKMGCSSLML
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcacatacagttggagggtgctcattggcacttatttttatcattgtgttgttgttg
gttaaagcaaatatagatgcatgcaagagaggagatgtgactgtggagccttcccatgta
atttcacttggatcagctgtcaatatttcatgctctttgaagcccgaacaaggctgccca
caatattccagtttaaacaggttaatcctctacaaggttaacgaaaaaatcaatttgctg
catggtcacttcctcagttctcaagtcacagatcttcctctgggtacaacagtgtttttc
tgcaaactggcctgtagcaaaaagaaggaattgcgaatatgtggggcagagatctcagtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggagaacgtgggact
gtgaactgcacctgggacagaggaagagacacccatctatatactacgtatactttacag
ttaaatggaccaaaaaatttaacatggcagaagcaatgtaatggtcattattgtgaccat
ttggaccttggagtcaacctaatccctgaattgcctgaatccagctacacagccaaggtc
actgctaccaatagacttggaaatgcttcttcgtttccatccacatttacattctgggac
atagtgaggcctcttcctccatgcgacatcagaatcaaatgtgtaaacgcttctgtgagc
agatgtatccttcagtggagcgacgaggggctggtgctgcttaatcgactcagatatcgg
cccaacagcagctggtcctggaaaatggtcagtgctacaaatgtcaaaggaagacatgat
ttgctggacctgaaaccatttacagagtatgaatttcagatttcctctaagctacatcta
tataaaggtagttggagtgattggagtgaatcgttgagaacacaaacaccagaagaagag
cctacagggacattggatgtctggtacatgaaacagcacattgactacagtagacaacag
atttctcttttctggaagaatatgagtctatccgaggcaagaggaaaaatcctccactat
cgcgtgaccttgcaggaggtggcaggggggaaagtcacactacagaacatcacagaacac
acctcctggacctgggtcattcctagaactgggaattgggttgtaactgtgtctgcagct
aactcaaaaggcagttccctgcccactcgtattaacataacggacctgcttgggccaggg
ttgccggctcctcgccaggtgtctgcaaactcgaagggtggggacaacattatggtgacg
tgggagcctccagggaaagctgcacctgctgtccaggagtatgtggtggaatggagggaa
cttcatcccaggggtggcacgcagccccctctgaactggctgcggactaccccctacaat
gtgtctgctctgatttcagagaacataaagccctacagctgctacgaaatcagcgtgtat
gcgctgtcgggggaccagagaggaggcagctccatccgggctaactctaaacacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaggggagtgtattaatttca
tggaatgaagttccagcccaggagcaaatgggctgcctcctccattatagaatatactgg
aaggaacaggactccaattcccagcctcaactttgtgaaattccctatagggtatcccta
aattcacattcaatagacagcctgcagcccagagtgacatatgtcctatggatgacagct
ctgacagctgctggtgaaagcccgccaggaaacaagagggaattttgtctggaaggtaaa
gccagttggagtgtgtttgtggcaccaagcatttgcattgctgtcgtcatagtgggcatt
ttctcaatgcgttacttccggcaaaaggtatttgttcttctttcggccctcagacctcag
tggtgtagtaaagaaattccagacccagcgaacagcacctgggccaagaaatatcccatc
gtggaggagaagacgcagctgcccttggacaggctcctgacagattggcccaatcctgaa
gaacctgagaccctggtcatcaccgaagtccttcatcaagtgaccccagtcttcagacat
ccctgtcaccccaactggccggacaaaggacaaggagtccaaggtcactacacctctgag
gaagacacagggtacagtgcctcaagcctaccaccttcaaaagctctcatagcagagaca
ggacaactagtggatctgtacaagatgctggggagcaggggccctgactcaaagccagga
cacctagtcagccccttgacagccctcccagtggactaccttcccacccatgagggatac
ttacccgccaacatagagtatctcccttcacatgaggttcctgtaactgaccctctggaa
gaactagagcctcagcacatctctctctctgttttcccttcaagttcccttcacccactc
accttctcctgtgataagaagctgactctggatcggttaaagatggggtgcagctccctc
atgctgtaa

KEGG   Ursus arctos horribilis: 113256701
Entry
113256701         CDS       T05909                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256701 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256701 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113256701 (IL12RB1)
   04659 Th17 cell differentiation
    113256701 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256701 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113256701 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113256701 (IL12RB1)
   04090 CD molecules [BR:uah04090]
    113256701 (IL12RB1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113256701 (IL12RB1)
CD molecules [BR:uah04090]
 Proteins
  113256701 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113256701
NCBI-ProteinID: XP_026356292
UniProt: A0A3Q7X100
LinkDB
Position
Unknown
AA seq 767 aa
MHARRMGGWVEDCRCEWMGGRVGGSIDGRADGWMDGPLASPQPEPLPHAVKDWECHYLLI
VFAAEACSTGQCCFQDLPYPDADSGSASGPRDLNCYRIVSAGYECSWQYEGPTAGVSHFL
RCCLRNGPCCYFAAGSATSLQFSDQDGVAVLQTVRLWVESRAENRTHRSPEIELSLHSTV
KYDPPQAGDITVSGSAGKVLLKWETPARQDGAEVQFRYRTPGSLWKLGDCRHREDPGFEA
CLCPWQMDAAQEFQLRRRRLRQEAPGNPWSNWSSPVCIPPEHSPQSTLTFSVEALRPDGK
RQVTLHGQLPRLELPEGCLGSNSGGEVTYRARLHMLSCTCKTKSTATFQLRKPLDLSGAA
YDLAIISRNRFGHGPSQTWHIPAQTHTHTEPGALNISVGANGTTMHWPAQARAKAYCIEW
QSQSQHGNLTNCTLTMPQDQDPTGMATHSWSRESGAMEQKVCYHITIFASPRPEKPTLWS
TILSTYHFGGNASGAGSPQHVLVKKLGQDSVSVDWTPSALSACPGVLKEYVVRCRDEEGN
VVSELPVKPTETQVTLGGLRAGTAYIVQVRADTATLRGAWSQPQQFSTEVQVSRLFDLSI
LLASLGSFASILLLGVLGYLGLNRAARHLCPPLPTPCASTVVEFPSSQGKQAWQWTSPAD
FPEEVSPKEALVVNMSWEKGEGTDLDTPVHLRKTQLLRGAPELALDAELPLEDRRQVQGH
PEARALGLGRQDGLEGNPAQVTGLLLPLGDLIQTPICSGPLQMGLEA
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgcatgcacgcaggatgggtggatgggtggaagactgcaggtgtgaatggatgggagga
cgggtgggtgggtccatagatgggagagcggatgggtggatggatggtcccttggccagc
ccccagcctgaacccctcccccatgcagtgaaagactgggaatgtcattatctcctcatt
gtctttgcagctgaagcctgcagtaccggtcagtgctgttttcaggacctgccatatccg
gatgcagactcaggctcggcttcaggccccagggacctgaactgctaccggatagtcagc
gctggttatgaatgctcctggcagtatgagggccccacggctggggtcagccacttcctg
aggtgctgcctccggaatgggccctgctgctactttgccgcgggctcggccaccagcctg
cagttctctgaccaggacggcgtagccgtgctccagactgtcaggctctgggtggaatct
cgagccgagaaccggacgcacaggtcgcctgagatcgaactgagccttcatagcacagtt
aaatacgaccctccgcaagctggagacatcaccgtgtcggggtccgcagggaaggtgctc
ttgaagtgggagaccccagcccgccaggatggcgccgaggtacagttccgctaccggaca
cctggcagcctgtggaagttgggcgactgcagacatcgagaggaccctggcttcgaggcc
tgcctctgcccctggcagatggacgcagcccaggaattccagctacgccggaggcgactc
cggcaggaagccccaggaaacccctggagcaactggagcagccccgtgtgtatcccccct
gaacattctccacagtccaccttgacgttctcagtggaggcgctccggccagatgggaag
aggcaggtgaccctgcacgggcagctgccccggctcgagcttccagaaggctgcctcggg
tccaactctggcggggaggtgacctaccgcgcccgcctgcacatgctatcctgcacatgt
aagaccaagtccaccgcgacctttcagctgaggaaaccgctcgacctctctggcgcagcc
tatgacctggccatcatctcccggaaccgcttcggccacggccccagccagacgtggcac
attcctgcccaaacccacacccacacagaaccaggggctctgaatatcagtgtcggagcc
aacgggaccaccatgcactggccagcccaggccagagccaaggcatattgcatcgagtgg
cagtcccagagccagcatgggaaccttaccaactgcaccctgactatgccccaggatcag
gaccctactggaatggcaacccacagctggagcagagaatctggggcaatggagcagaag
gtgtgttaccacatcacgatctttgcctctccacgcccagagaagcccactttgtggtcc
acgatcttgtccacctaccactttgggggcaatgcctcgggggccggaagcccacagcac
gtgttggtgaagaagcttggccaggactccgtgtctgtggactggacgccatccgcgctg
agcgcctgccccggggtcctgaaggagtacgtcgtgcgctgccgggatgaggagggcaac
gtcgtgtccgagctgcccgtgaagcccacggagactcaggtcacgcttggtggccttcgg
gctggcacagcctacatcgtgcaggttcgagcagacacggcgacgctgcggggcgcctgg
agccagccccagcagttcagcaccgaagtccaggtttcccggttgttcgatttgtccata
ctccttgcgtctctggggagcttcgccagcatccttctcctgggtgtccttgggtacctc
ggcctgaacagggctgcacggcacctgtgtccgcccctgcccacaccctgtgccagcact
gtggtcgagttccctagcagccaggggaagcaggcttggcaatggacaagcccggcagac
ttcccggaggaggtgtccccgaaagaggccttggtggtgaacatgtcctgggaaaaaggt
gagggaactgacctggacacacctgtgcatctcaggaagacacagctacttcggggtgct
cctgagctggccttggatgcagagctacccttggaggacaggagacaggtgcaaggccac
cctgaggctcgggctctggggctgggcaggcaggatggtctggagggcaaccctgcccag
gtgactggactcttgctgcccttgggggacctaatacagacccccatatgcagtggccct
ttgcaaatgggcctggaggcctaa

DBGET integrated database retrieval system