KEGG   Ursus arctos horribilis: 113254554
Entry
113254554         CDS       T05909                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254554 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254554 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113254554 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254554 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254554 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254554 (IL23R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113254554 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL12p40_C Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 113254554
NCBI-ProteinID: XP_026353637
UniProt: A0A3Q7WT38
LinkDB
Position
Unknown
AA seq 631 aa
MNQVTIQWDVIIALYIFFNWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLYFYKNGIKERFQVTRINKTTARLWYNNFLEPHASMYCTAECPGYFQETLICGKDIS
AGYPPDVPDKVTCVIYEYSGNMTCTWNSGKPTYIDTKYVVYVKSLETEEEQQYLSSSYIN
ISTDSLQSGKKYLVWVQAANALGMENSKQLQINLDDIAIPSASIISRAEFINTTMPKTII
HWHSQTAIKNISCEMRYKATTNQTWKVKKFDTNFTYEQQSEFYLESNTNYIFQVRCQETG
KKYWQPWSSPFSHKTAETVPQITWKSFQHDTQNSEHLIASIFKGHLTSDNRQQDIRLLSG
MVFFAVMLSIISLIGILNRSLRTGIKRRILLLIPKWLHEDIPNVENSNVVKMLQEKSEFM
NNNSSEQVLYVDPVITEIEIFLPEEHKPMDYKTEENTGSLETRDCQQKSLLTNTTVVYIP
GLSTGYKPQISNFLTGGNHLSKNDDTSSSTLKPPADSLDLGENARFKKYPNFAFSVSSMN
SLSNTLFLEELSLILNQGEHSPLDMQNSVEGETTMLLEDASSNKTIPEQTLLPDEFVSCL
GAMNEELPSINSYFPQNILENHFNTISLLEK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggatgtgataatagctctttacatattcttcaactgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatactgtcaagcagcaattaagaactgccaa
ccaaggaaactttatttttataaaaatggcatcaaagaaagatttcaagtcacaagaatt
aacaaaacgacagctcggctttggtataacaactttctggagccacatgcttctatgtac
tgcactgctgaatgtcctggatattttcaagagacactgatatgtggaaaagacatttct
gctggatatccaccagacgttcctgacaaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgtacctggaactccgggaagcccacctacatagacacaaagtatgtggtg
tacgtgaagagtttagagacagaagaagagcaacaatatctttcttcaagttatattaac
atctccactgattcattgcaaagtggcaagaaatatttggtgtgggtccaagcggcaaat
gcattgggcatggagaactcaaaacaactgcaaattaatctggatgatatagcgatacct
tctgcatccatcatttccagggctgagtttataaatactacaatgcccaagaccataatt
cactggcatagtcaaacagcaattaaaaatatttcctgtgaaatgagatacaaggctaca
acaaaccaaacatggaaggttaaaaaatttgataccaattttacatatgagcaacagtca
gaattctacttggagtcaaacactaattatatatttcaagtgagatgccaagaaacaggt
aaaaagtactggcagccctggagttcacccttttctcataaaacagctgaaacagttccc
cagatcacatggaaatcattccaacatgatactcagaattctgagcatctaattgcttcc
atctttaaaggacatcttacttctgacaacaggcaacaagacattagacttttatcagga
atggtcttctttgctgttatgttgtcaattatttctttgattgggatattaaacagatca
ctgcgaactggaattaaaagaagaatcttattgctaataccaaagtggcttcatgaagat
attcctaatgtggaaaacagtaatgttgtaaaaatgctacaggaaaaaagtgaatttatg
aataataattctagcgagcaggtcctttatgttgatccggtgattacagagatagaaatc
tttcttccagaagaacacaagcccatggactacaagacagaagagaatacaggatccctg
gagacaagagactgccagcagaagtcactactcaccaacactacagttgtgtatattcct
ggtctcagcactgggtataaaccccagatttcaaattttctcactgggggaaaccatctc
agcaaaaatgatgacacatcttcctcaactctcaaaccaccagctgattccttagaccta
ggggaaaatgccaggtttaaaaaatacccgaattttgctttttctgtctcaagtatgaat
tcgctaagcaacacactatttcttgaagaattaagcctcattttaaatcaaggagaacac
agtcctctggacatgcaaaactcagttgaaggagaaactaccatgcttttggaagatgct
tcatccaacaaaactattccagaacagaccctgttgcccgatgaattcgtttcctgtttg
ggggccatgaatgaggagttgccatctattaattcttattttccccaaaatattttggaa
aaccacttcaatacgatttcactcttggaaaagtag

DBGET integrated database retrieval system