KEGG   Ursus arctos horribilis: 113254611
Entry
113254611         CDS       T05909                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04024  cAMP signaling pathway
uah04137  Mitophagy - animal
uah04210  Apoptosis
uah04310  Wnt signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04530  Tight junction
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05030  Cocaine addiction
uah05031  Amphetamine addiction
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05224  Breast cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113254611 (JUN)
   04012 ErbB signaling pathway
    113254611 (JUN)
   04310 Wnt signaling pathway
    113254611 (JUN)
   04668 TNF signaling pathway
    113254611 (JUN)
   04024 cAMP signaling pathway
    113254611 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113254611 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    113254611 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113254611 (JUN)
   04530 Tight junction
    113254611 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113254611 (JUN)
   04621 NOD-like receptor signaling pathway
    113254611 (JUN)
   04625 C-type lectin receptor signaling pathway
    113254611 (JUN)
   04660 T cell receptor signaling pathway
    113254611 (JUN)
   04658 Th1 and Th2 cell differentiation
    113254611 (JUN)
   04659 Th17 cell differentiation
    113254611 (JUN)
   04657 IL-17 signaling pathway
    113254611 (JUN)
   04662 B cell receptor signaling pathway
    113254611 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113254611 (JUN)
   04915 Estrogen signaling pathway
    113254611 (JUN)
   04921 Oxytocin signaling pathway
    113254611 (JUN)
   04926 Relaxin signaling pathway
    113254611 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113254611 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113254611 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254611 (JUN)
   05203 Viral carcinogenesis
    113254611 (JUN)
   05231 Choline metabolism in cancer
    113254611 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113254611 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113254611 (JUN)
   05211 Renal cell carcinoma
    113254611 (JUN)
   05224 Breast cancer
    113254611 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113254611 (JUN)
   05321 Inflammatory bowel disease (IBD)
    113254611 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    113254611 (JUN)
   05031 Amphetamine addiction
    113254611 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113254611 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113254611 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113254611 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113254611 (JUN)
   05135 Yersinia infection
    113254611 (JUN)
   05133 Pertussis
    113254611 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113254611 (JUN)
   05170 Human immunodeficiency virus 1 infection
    113254611 (JUN)
   05162 Measles
    113254611 (JUN)
   05161 Hepatitis B
    113254611 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113254611 (JUN)
   05169 Epstein-Barr virus infection
    113254611 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    113254611 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    113254611 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113254611 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113254611 (JUN)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    113254611 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 113254611
NCBI-ProteinID: XP_026353768
UniProt: A0A3Q7VXZ5
LinkDB
Position
Unknown
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtctgcggcgcagccggtcagcggggcg
ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag
ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg
cagcacccgcggcttcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg
gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg
aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc
gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

KEGG   Ursus arctos horribilis: 113270317
Entry
113270317         CDS       T05909                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04024  cAMP signaling pathway
uah04210  Apoptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04713  Circadian entrainment
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04935  Growth hormone synthesis, secretion and action
uah05031  Amphetamine addiction
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05224  Breast cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05323  Rheumatoid arthritis
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113270317 (FOS)
   04668 TNF signaling pathway
    113270317 (FOS)
   04024 cAMP signaling pathway
    113270317 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113270317 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113270317 (FOS)
   04660 T cell receptor signaling pathway
    113270317 (FOS)
   04658 Th1 and Th2 cell differentiation
    113270317 (FOS)
   04659 Th17 cell differentiation
    113270317 (FOS)
   04657 IL-17 signaling pathway
    113270317 (FOS)
   04662 B cell receptor signaling pathway
    113270317 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    113270317 (FOS)
   04917 Prolactin signaling pathway
    113270317 (FOS)
   04921 Oxytocin signaling pathway
    113270317 (FOS)
   04926 Relaxin signaling pathway
    113270317 (FOS)
   04935 Growth hormone synthesis, secretion and action
    113270317 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    113270317 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    113270317 (FOS)
   04728 Dopaminergic synapse
    113270317 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113270317 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113270317 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270317 (FOS)
   05231 Choline metabolism in cancer
    113270317 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113270317 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113270317 (FOS)
   05224 Breast cancer
    113270317 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113270317 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    113270317 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113270317 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113270317 (FOS)
   05135 Yersinia infection
    113270317 (FOS)
   05133 Pertussis
    113270317 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113270317 (FOS)
   05170 Human immunodeficiency virus 1 infection
    113270317 (FOS)
   05162 Measles
    113270317 (FOS)
   05161 Hepatitis B
    113270317 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270317 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    113270317 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    113270317 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113270317 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113270317 (FOS)
   04131 Membrane trafficking [BR:uah04131]
    113270317 (FOS)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    113270317 (FOS)
Membrane trafficking [BR:uah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    113270317 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 113270317
NCBI-ProteinID: XP_026375263
UniProt: A0A3Q7XL05
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGSYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEATTPESEEAFT
LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggagacaatctctcctactaccactcaccggccgactccttctccagcatg
ggctctcccgtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttt
atcccgacggtgactgccatctccaccagcccggacctgcagtggttggtgcagcccacc
ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccctacc
ccctccgctgggtcttactccagggctggagtcgtgaagaccatgacgggaggcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccggaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag
ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacttgctgaaggagaaggaaaaactagagttcatcctggcggctcac
cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc
ctagatctgagcgggggcctgcccgaagccaccacccccgagtccgaggaggctttcacc
ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc
agcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcgtccaggccc
agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca
gcggactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag
ggcagcagcagcaacgaaccgtcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system