KEGG   Ursus arctos horribilis: 113255360
Entry
113255360         CDS       T05909                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04390  Hippo signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113255360 (FGF1)
   04014 Ras signaling pathway
    113255360 (FGF1)
   04015 Rap1 signaling pathway
    113255360 (FGF1)
   04390 Hippo signaling pathway
    113255360 (FGF1)
   04151 PI3K-Akt signaling pathway
    113255360 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255360 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255360 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    113255360 (FGF1)
   05218 Melanoma
    113255360 (FGF1)
   05224 Breast cancer
    113255360 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255360 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255360 (FGF1)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255360 (FGF1)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113255360 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113255360
NCBI-ProteinID: XP_026354806
UniProt: A0A3Q7V0K5
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTANEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagtgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacagcaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system