KEGG   Ursus arctos horribilis: 113255465
Entry
113255465         CDS       T05909                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255465 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255465 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113255465 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113255465 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255465 (IL21)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255465 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 113255465
NCBI-ProteinID: XP_026354870
UniProt: A0A3Q7VRL2
LinkDB
Position
Unknown
AA seq 153 aa
MRYSAGNMEKIVICLTVIFLGTVAHKSSFQEQDRYLIRMRQLINIVDQLKNYVNDLDPES
LPAPEDVKRHCEQSAFSCFQKAQIKAANTGGNEQLISVLTKQLKRKLPPTNAGRRQKHRP
TCPSCDSYEKTPPKEFLERLKSLIQRMIHQHLS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagatacagtgctggcaacatggagaagatagtcatctgcctgacggtcatcttcttg
gggacagtggctcataagtcaagcttccaagagcaagatcgctacttgattagaatgcgt
caacttataaatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaatct
ctgccagctccagaagatgtaaagagacattgtgagcagtcagctttttcatgttttcag
aaggcccaaataaaggcagcaaatacaggaggcaatgaacaactaatcagtgtattaact
aaacagctgaagaggaaactacctcccacaaatgcaggcagaagacagaaacacagacca
acatgcccctcatgtgattcttatgagaaaacaccacccaaagaattcctagaaagactg
aaatcactcatccaaaggatgattcatcagcatctctcctag

DBGET integrated database retrieval system