KEGG   Ursus arctos horribilis: 113255569Help
Entry
113255569         CDS       T05909                                 

Gene name
ENPEP
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
uah  Ursus arctos horribilis
Pathway
uah04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    113255569 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113255569 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113255569 (ENPEP)
   04090 CD molecules [BR:uah04090]
    113255569 (ENPEP)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     113255569 (ENPEP)
Peptidases and inhibitors [BR:uah01002]
 Metallo peptidases
  Family M1
   113255569 (ENPEP)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113255569 (ENPEP)
CD molecules [BR:uah04090]
 Proteins
  113255569 (ENPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Cyclophil_like DUF1570
Motif
Other DBs
NCBI-GeneID: 113255569
NCBI-ProteinID: XP_026354972
UniProt: A0A3Q7WX34
LinkDB All DBs
Position
Unknown
AA seq 952 aa AA seqDB search
MNFAEGEDAKRYCIKTKHVAIICAVVVGVGLIVGLSVGLTRSSSSTGDAGQGPAPAPSQV
PSPEIPPEDQGVCPASEDESGDWTDFRLPDFISPVHYDLEVKPLLEEDTYTGSVTISINV
SAPTRYLWLHLRETRITQLPELKRSSGEQVEVRRCFEYKKQEYVVMEAGEELAASSGEGA
YLLTMKFAGWLNGSLVGFYRTTYEENGQIKSIAATDHEPTDARKSFPCFDEPNKKATYTI
SIVHPKEYQAVSNMPVEKEESVDDKWNRTTFEKSVPMSTYLVCFAVHQFDRVERLSKRGI
PLTIYVQPEQKHTAEYAANITKIVFDYFEEYFAMDYALPKLDEIAIPDFGTGAMENWGLI
TYRETNLLYDPEESASTNQQRVASVVTHELVHQWFGNTVTMDWWEDLWLNEGFASFFEFL
GVNQAENEWQMRDQILLEDVFPIQEDDSLMSSHPIVVTVTTPAEITSVFDGISYSKGASI
LRMLEDWLTPEKFQKGCQIYLEKYKFKNAKTEDFWGALEEASNLPVKEVMDTWTTQMGYP
VLDVKDMRNIIQKRFLLDSRANSSEPHSPLGYTWNIPVKWTEDNVSSITVYNRSETGGIT
LNSSNPAGNVFLKINPDHIGFYRVNYEVPTWEQIATNLSINHTDFSSADRASLIDDAFAL
ARAQLLDYKMALNLTKYLRMEEDFLPWQRVISVITYIISMFEDDKELYPVIEEYFQSQVK
PIADLLGWNDVGDHLTKLLRASVLGLACKMGDQEALENATQLFQQWLSGTVRLPVNLRLL
VYQYGMQNSGNETSWNYTLDQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDFLKDPNLI
KSQDVFTVIRYISYNSYGKYMAWNWIQLNWEYLVNRYTLNDRNLGRIVTIAEPFNTELQL
WQMESFFKKYPDAGAGETPREQVLETVKNNIEWLRQNRDTIRQWFLDLPRNG
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcggagggagaggacgctaagagatactgcattaaaaccaaacatgtagcc
ataatctgtgcggtggtggtgggggtaggattaatagtaggactttccgtgggcttgacc
aggtccagcagctccaccggggacgccgggcagggcccagccccggctccttcccaggtt
ccttcccctgagatccctccggaggaccagggggtctgccctgccagcgaagatgaaagt
ggagactggacagacttcaggctgccggacttcatcagccccgtgcactatgacttggag
gtgaagcccctgctggaggaggacacgtacacaggcagcgtgaccatctccatcaacgtg
agcgcgcccacccggtacctgtggctgcacctgcgggagaccaggatcacccagctcccc
gagctcaagaggtcctccggggagcaggtggaagtcaggcggtgcttcgagtacaaaaag
caggagtatgtggtgatggaggcaggagaagagcttgcagccagcagtggcgagggcgcc
tacctcctgactatgaagttcgccggctggctgaacggctcgctcgtgggattttataga
acgacgtacgaggagaacggacaaatcaagagcatagcggccactgatcatgaaccaaca
gatgccagaaaatccttcccttgttttgatgagcccaacaaaaaggcaacttacacaata
tccatcgtccaccccaaagaatatcaggcagtttcaaatatgccagtggagaaagaagag
tcggtggatgataaatggaatagaacaactttcgagaagtctgtccctatgagcacctac
ctggtgtgcttcgccgtacatcaattcgaccgcgttgagaggctatcaaagcgaggaata
cctctcactatatatgtccagccagagcaaaagcacacagctgaatacgccgcaaacata
actaaaattgtgtttgattattttgaagaatactttgctatggattatgctcttcctaaa
ttagatgaaatcgctattccagactttggcaccggggccatggagaactggggactcatc
acttacagagaaacaaacttgctttatgaccctgaggaatcagcctcgacaaaccagcag
agggtggccagtgtggttacccatgaacttgtgcatcagtggtttggaaatactgtgacc
atggactggtgggaagacttgtggctaaatgaaggatttgcttcgttctttgagttcctg
ggagtaaaccaagcagaaaacgagtggcaaatgagagaccagatattacttgaagatgtg
ttccccatacaagaggatgattctttgatgtcttcacacccaattgttgtcactgtgaca
actcctgctgaaataacatctgtttttgatggaatatcctatagcaagggagcgtccatt
ctgaggatgcttgaagactggttaacaccagagaaatttcaaaaaggatgtcagatttac
ttggaaaaatacaaattcaagaatgcaaaaactgaagatttttggggagcacttgaagag
gcaagtaatctaccagtgaaagaagtaatggatacgtggaccacacagatgggttatcct
gtacttgatgtgaaagatatgaggaacatcatacagaaacgctttctgttggactcaaga
gcaaattcttctgagccacattcacctcttggttacacatggaatattccagttaaatgg
actgaagataatgtatcgagtattacagtctacaacaggtcagaaacaggaggaatcact
ttgaactcttctaatcctgctggaaatgtttttctcaaaataaaccctgatcatattggg
ttttatcgtgtaaattatgaagtaccaacttgggaacagatagctaccaatctttccatc
aaccacacggacttttcttctgctgaccgtgcaagtcttattgatgatgcttttgcctta
gcaagagctcaacttctagattacaagatggctttaaacttgaccaagtatctcagaatg
gaagaagattttttaccgtggcagagagtgatttcagtcataacctatatcattagcatg
tttgaagatgataaagagctataccctgtgattgaggaatacttccaaagtcaagtgaag
cccattgcagatcttctgggatggaatgatgttggagaccaccttacaaagttactccgt
gcctccgtgttagggcttgcatgcaaaatgggagatcaagaagccttggaaaatgctacc
caattatttcagcagtggctaagtgggactgtaaggcttcctgtaaatctcaggcttttg
gtttatcagtatggaatgcagaactctggcaatgagacttcatggaactatactcttgat
caataccagaaaacttcattagctcaggaaaaagaaaaactgttgtatggattagcatcg
gtgaagaatgttactcttttgtcaaggtatttagattttctcaaggacccaaaccttatt
aaatctcaggatgtgtttacagtcatccgatatatctcatacaacagctatgggaagtac
atggcctggaattggattcagctcaactgggaatatctagtcaacaggtacactctcaac
gacagaaaccttggcaggattgtcacaatagcagaacctttcaacactgaactacagctc
tggcagatggagagcttttttaaaaaatatccagatgctggagcaggagaaacacctagg
gagcaagtgctggaaacagtgaagaacaatatcgagtggttaaggcaaaacagagacacc
ataagacagtggtttttggatttacctaggaacggttaa

DBGET integrated database retrieval system