KEGG   Ursus arctos horribilis: 113255635Help
Entry
113255635         CDS       T05909                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04151  PI3K-Akt signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255635 (IL2)
   04151 PI3K-Akt signaling pathway
    113255635 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255635 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113255635 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113255635 (IL2)
   04660 T cell receptor signaling pathway
    113255635 (IL2)
   04658 Th1 and Th2 cell differentiation
    113255635 (IL2)
   04659 Th17 cell differentiation
    113255635 (IL2)
   04672 Intestinal immune network for IgA production
    113255635 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255635 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113255635 (IL2)
   05321 Inflammatory bowel disease (IBD)
    113255635 (IL2)
   05330 Allograft rejection
    113255635 (IL2)
   05332 Graft-versus-host disease
    113255635 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113255635 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113255635 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113255635 (IL2)
   05162 Measles
    113255635 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113255635 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255635 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255635 (IL2)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255635 (IL2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113255635 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2
Motif
Other DBs
NCBI-GeneID: 113255635
NCBI-ProteinID: XP_026355067
UniProt: A0A3Q7WXD6
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MYKMQLLYCIALTLVLVANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG
SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt
gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg
ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system