KEGG   Ursus arctos horribilis: 113255691
Entry
113255691         CDS       T05909                                 

Gene name
MAML3
Definition
(RefSeq) mastermind-like protein 3
  KO
K06061  mastermind
Organism
uah  Ursus arctos horribilis
Pathway
uah04330  Notch signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    113255691 (MAML3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113255691 (MAML3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113255691 (MAML3)
SSDB
Motif
Pfam: MamL-1
Other DBs
NCBI-GeneID: 113255691
NCBI-ProteinID: XP_026355165
UniProt: A0A3Q7VSC7
LinkDB
Position
Unknown
AA seq 1109 aa
MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGCGGGGSGG
PGGGSAAVPKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQRTLE
QRAKKSGAGSGKQQHQSKPQQDAEAASAEQRNHTLIMLQETVKRKLEGARSPLNGDQQNG
ACDGSFSPTSKRIRKDIPTGMDTINMPLPSASPLHQLDLKPSLPLQNSGTHTPGLLEDLS
KNGRLPEIKLPVNGCSDLEDSFTILQSKDLKQEPLDDPTCIDTSETSLSNQNKLFSDINL
NDQEWQELIDELANTVPEDDIQDLFNEDFEEKKEPEFSQPATETPLSQESASVKSDPSHS
PFAHVSMGSPQARPSSSGPPFSTVSTATSLPTVASTPAAANPASSPANCAVQSPQTPNQA
HTPGQAPPRPGNGYLLNPAAVTVAGSASGPVAVASSDMSPAEQLKQMAAQQQQRAKLMQQ
KQQQHANQTSSWSPLGPPSSPYGAAFAAEKPNSPMMYPQAFNNQNPIVPPMANNLQKTTM
NNYLPQNHMNMINQQPNNLGTNSLNKQHNILTYGNTKPLTHFNADLSQRMTPPMANPNKN
ALLPYIQQQQQQPPPPPPPPQQPPPPPQLPAPRAHLSEEQKRMLLMKQKGVMTQPLAYAA
LPSHGQEQHPVGLPRTTGPMQSSVAPGSGGMVSAASGAGPGFLGSQPQAAIMKQMLMDQR
AQLMEQQKQQFLREQRQQQQQQQHILAEQQLQQSHLPRQHLQQQRNPYPVQQVNQFQGSP
QDIAAVRSQAALQSIRTSRLMAQNAGMMGMGPSQNPGTMATAAAQSEMGLAPYSNTPTSQ
PGMYNMSTGMTQMLQHPNQSGMSITHNQAQGPRQPTSGQGVGMVSGFGQSMLVNSAITQQ
HQPMKGPVSQALPRPQGPPRLQGIMGTVQQGTQSWPQRSLQGMPGRTSGELGSFNNGTGY
PLQAGQPRLTKQHFPQGLSQVVDANTGAVRTLNPAAMGRQMMPPLPGQQGSGQARPMVMS
GLSQGVPGMPAFSQPPAQQQMPSGSFAPSSQSQAYERNPPQDMSYNYSGEAAGASFPGLS
DSADLVDSIIKAGPGDEWMQELDELFGNP
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgggggatttcgcagcccccgctgctgccgcgaatggcagtagtatttgcatcaacagt
agcctgaacagcagcctcggcggggccgggatcggtgtgaataatactcccaatagtact
cccgctgctccgagtagcaatcaccccgctgccggctgtggcggcggcggctccgggggc
cccggcggcggctcagcggcggtccccaagcacagcacggtggtggagcggctccgccag
cgcatcgagggctgccggcggcaccacgtcaactgcgagaacaggtatcagcaggctcag
gtggagcagctggagctggagcgccgggacactgtgagcctctaccagcggaccctggag
cagagggccaagaaatcgggcgccggctcgggcaagcagcagcaccagagcaaaccccag
caagatgcggaggctgcttcggcggagcagaggaaccacacgttgatcatgctccaagag
actgtgaaaaggaagttggaaggagctcgatcaccacttaatggagaccaacagaatggt
gcttgtgatgggagtttttctccaacaagcaagagaatacgaaaggacattcctacagga
atggacaccatcaacatgccactgccttcagcttctcctcttcaccaacttgacctgaag
ccttcactgcccttgcagaatagtggaactcacactcctgggcttctagaagacctaagt
aagaatggtaggcttccagagatcaaacttcctgtcaacggttgcagtgacctggaggac
agcttcaccatcctgcagagcaaggacctcaaacaagagcctctagatgaccctacttgc
atagacacatcagaaacatctctttcaaatcagaacaagctgttctcagacattaacctg
aatgaccaggagtggcaagaattaatcgatgagttggccaacacggttcctgaagatgac
atacaggacctgttcaacgaagactttgaagagaagaaggagcccgaattctcacagccg
gccacagagacccctctctcccaggagagtgcaagtgtgaagagcgacccctctcactct
ccttttgcacacgtctccatgggatccccgcaggcgaggccctcgtcttctggccctccc
ttttctaccgtgtccacggccacgagtttacctacggtcgccagcactcccgcagctgca
aaccccgccagctcaccagcaaactgtgctgtccagtcccctcagactccgaaccaagcc
cacactccaggccaagccccacctcggcctggaaacggttatctccttaatccagcggcc
gtgaccgtggcgggctccgcgtcgggcccggtggccgtggccagctccgacatgtcccca
gcggagcagctcaagcagatggctgcgcagcagcaacaaagggccaagctcatgcaacag
aagcagcagcagcacgccaaccagacttccagctggtctcccttagggcccccgtccagc
ccctacggagcagctttcgctgcggaaaaaccaaatagcccaatgatgtacccccaagcc
tttaacaaccaaaaccccatagtgcctcccatggccaacaacctgcagaagacgacaatg
aataactacctccctcagaaccacatgaatatgatcaatcagcagccaaataacttgggt
accaactccttaaacaaacagcacaacatcctcacgtacggcaacactaagcctctgacc
cattttaacgcagacttgagtcagaggatgacccccccgatggccaaccccaacaaaaac
gccctgctgccctacatccagcagcagcagcagcagccgcccccgccgccgcccccgccc
cagcagccgccgccgccgccgcagctcccggcgcccagggcgcacctgagcgaggagcag
aagcgcatgcttctcatgaagcagaagggagtgatgacgcagccgctggcgtacgccgcg
cttccgtcccacggtcaggagcagcaccccgttggactgccccggaccacaggcccaatg
cagtcctcggtggccccaggctcgggcggcatggtgtccgcagccagtggtgcgggtccc
ggcttcctcggcagccagccgcaggcagccatcatgaagcagatgctcatggaccagcgg
gcccagctgatggagcagcagaagcagcagttcctgcgggagcaaaggcagcagcagcag
cagcagcagcacattctggccgagcagcagctgcagcagtcccatttaccgcgccagcac
ctccagcagcagcggaatccatacccagtgcagcaggtcaatcagttccaaggttctccc
caggatatagcagccgtgagaagccaagcagccctccagagcattcgaacgtcacggttg
atggcacagaacgcaggcatgatgggaatgggaccctcccagaacccagggacaatggcc
acggcagcagcccagtcggagatgggactggccccttacagcaacacacctaccagccaa
ccaggaatgtacaatatgagcacaggaatgacccaaatgttgcagcacccaaaccaaagt
ggcatgagcatcacacacaaccaagcgcaggggccaaggcagcccacctccgggcaaggg
gttgggatggtgagtggtttcggtcagagcatgctggtgaactcagccattacccagcag
caccagccgatgaaagggccggtgagccaagcgctgccgaggccccagggcccgcccagg
ctgcagggcatcatgggaacggtccagcagggcacgcagagctggccgcagaggagctta
caggggatgccggggaggactagtggcgaactgggatcgttcaacaacggcaccggctac
ccccttcaggctggccagccgaggctgaccaagcaacacttcccgcagggactgagccag
gttgtggatgccaacactggcgccgtgcgaaccctcaacccggccgccatgggccggcag
atgatgccaccgctcccggggcagcaaggcagcggccaggccaggccgatggtcatgtct
ggcctgagccagggcgtccccggcatgccagccttcagccagcccccagcacagcagcag
atgcccagcggcagcttcgccccgagcagccagagccaggcctatgagcggaacccccct
caggacatgtcctacaattacagcggcgaagcggccggcgcctccttccccggcctctcg
gacagcgcggacctcgtggactccatcatcaaagccgggccgggggacgagtggatgcag
gagcttgatgagttgtttgggaacccctag

KEGG   Ursus arctos horribilis: 113259807
Entry
113259807         CDS       T05909                                 

Gene name
MAML2
Definition
(RefSeq) mastermind-like protein 2 isoform X1
  KO
K06061  mastermind
Organism
uah  Ursus arctos horribilis
Pathway
uah04330  Notch signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    113259807 (MAML2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113259807 (MAML2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113259807 (MAML2)
SSDB
Motif
Pfam: MamL-1
Other DBs
NCBI-GeneID: 113259807
NCBI-ProteinID: XP_026361080
UniProt: A0A3Q7W876
LinkDB
Position
Unknown
AA seq 1109 aa
MGDTAPPQAPTGGLGGAPGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYER
GRAESSDRERESTLQLLSLVQHGQGARKAGKHTKATATAATTTAPPPPPAAPPTASQATA
TAAPPPPPDYHHHHQQHLLNSSNNGGGGGIDGEQQSQASTPGDQRNSALIALQGSLKRKQ
VVNLSPANSKRPNGFVDNSFLDIKRIRVGENLSAGQGGLQVNNGQNQMMSGTLPMSQAPL
RKTNTLPPHAHPPGNGIFNMGLKEVKKEPGETLSCSKHMDGQMSQESMFSSRFGEDPVEQ
LMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQRSTPRPSLPME
KPVIKSEYSPGLTQGPSGSPQLRPPSAGPAFSMANSALSASSPVPSVPQSQAQPQTSGAS
RALPSWQEVSHAQQLKQIAANRQQHVRMQQHQQQHQPTTWPALPSSTGPSPGPFGQEKIP
SPSFGQQPFSPQSSPMPGVAGGGSQSKVMANYMYKASPAAQGGHLDVLMQQKPQDLSRSF
MNTPHTAMEPRHGNTKPLFHFNSDQASQQMPSVLPSQSKPSLLHYTQQQPQQPQQPQQPQ
QPQQPQSSISAQPPPPPPPSQPAQPLSSQPLLRSPLPLQQKILLQKMQNQPITGLGYQVS
QQHRQDQHSVVGQNTGPSPSPNPCSNPNSGSGYMNSPQSLLNQQLMGKKQTLQRQILEQK
QQLLLQQQMLVDAEKIAPQDQINRHLTRPPPDYKDQRRNASSMQPTAAQYSGGSSTVSLN
SNQALANPVSTHAILTSNSSLMSTSHGTRMPSLPTGVQNMGMYGNLPCSQPGTYSVTSGV
NQLTQQRNANQLIANQNNPLMPRPPTLGAGNNNNVATFGAGPVSNSQQLRPNLTHSMASM
PAQRTSNVMITSSTTAPNWASQEATTKQQEALKSTAVRFPTGTPAAYTPNQSLQQAVGSQ
QFSQRPVVPPNQLTPAVQMRPMNQLSQTLNGQTMGPLRSLNLRPSQLSTQILPNLNQSGT
GLSQSRTGISQPPSLTPGSFPSPNQSSRAFQGTDHGSDLAFDFLNQQTDNLGPALNSDAD
FIDSLLKTEPGNDDWMKDINLDEILGNNS
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgggggacacagcgcccccacaggcccccacaggagggctggggggggcccctggggcg
gggctccttggagggggctcagtcaccccgagagtgcacagtgctatcgtggagcgcctc
cgggctcggatcgctgtctgccgccagcaccacctgagctgtgaaggacgctatgaacgt
ggtcgggctgagagttcagaccgggaaagagagagcaccttgcagctcctgagcctggta
cagcatggccagggggctaggaaggctggaaaacacaccaaggccacagccactgccgcc
accactacagcccctccaccgccccctgctgcccctcctacagcctctcaagcaacagcg
acagcagccccaccgcccccaccagactatcaccatcaccaccagcagcacctgctgaac
agtagcaataatggtggcggtggtgggatcgacggggagcagcagtcacaagcttcgacc
cctggggaccagaggaactcagccctgattgcgctccagggttccttgaaaagaaaacag
gtggttaacctatctcctgcgaacagcaagaggcccaatggctttgtcgacaactcattc
cttgatatcaagagaatccgtgttggggagaacctctctgcaggacaagggggcctccaa
gtaaataatggacaaaatcagatgatgtcagggaccttgcccatgagccaagcacccctg
cggaagacgaacactctgccaccccacgcacatcctcctggaaatggtatctttaacatg
ggcttgaaggaagtgaagaaggaacccggagagactctgtcttgcagtaagcacatggac
ggccagatgagccaggagagtatgttttccagtaggttcggcgaggaccctgtagagcag
ctgatggacccagagctgcaggagctgttcaatgagctgaccaacatttctgtgcctccc
atgagtgacctggagctggagaacatgatcaatgccaccatcaagcaagatgacccattt
aacatcgacttgggtcagcagagccagaggagcactcccaggccctccctgcccatggag
aagccagtgatcaagagtgaatactccccaggcctaacccagggcccctccggctcgcct
cagttgaggcccccctctgctggcccggcattctccatggccaactccgccctctccgct
tcctccccagtcccttctgtccctcagagccaggctcagcctcagacatcgggagcaagc
cgggccctgccgagctggcaggaagtctcccacgcccagcagctcaaacagatcgcggcc
aaccggcagcagcatgttcggatgcagcagcaccagcagcagcaccagcctaccacctgg
ccggccttgccctcctccacggggccatcgccaggcccattcgggcaggagaaaatcccc
agcccttctttcggtcagcagccattcagcccgcagagctcccccatgccgggggtagcg
ggcggtggcagccagtcaaaggtgatggctaactacatgtacaaggccagcccggcggcg
cagggagggcacctcgacgtgctcatgcaacagaagcctcaggatctcagtcgaagtttt
atgaacaccccgcacacagccatggagccccgtcatggcaacactaagcctttgttccat
tttaactctgatcaagcaagccagcagatgccttctgttttgccttcccagagtaagcct
tctctcctacactacacccagcagcagccccagcagccgcagcagccgcagcagccgcag
cagccccagcagccccagagctccatttcagctcagccaccgccgccgccaccaccgtcc
cagcccgcccagcccctgtcaagccagcctttgctgaggtcccccttgccgctccagcag
aagatcctgcttcagaaaatgcagaaccagcccatcacaggcctgggatatcaagtctcc
caacagcaccgacaggatcaacactctgtggtaggccagaacacaggccccagtccaagt
cccaacccctgctcaaatccaaacagcggaagtggttacatgaactccccgcaatcactg
ttgaatcagcaattgatgggaaagaaacagactctacagaggcagatcctggagcagaaa
cagcagcttctcctccagcagcagatgctggttgatgcggagaagattgctccgcaggat
cagataaacagacatttgacaaggccacccccagattacaaagaccaaagaagaaatgcg
agcagtatgcagccaactgctgctcagtattctggtggctcatcaaccgtgagtttaaac
tctaaccaggctttggcaaacccagtttcgacacatgccattttgacttcgaattccagc
ctcatgtctacttcccatgggacaagaatgccatcattacccacaggagttcagaatatg
gggatgtatggaaatctgccttgcagtcaacctggcacgtacagtgtcacttcaggagtg
aatcagctgacccaacagagaaacgcaaaccaattgatagcaaatcaaaacaaccctctg
atgccacgaccacctaccttaggggcaggtaataataataatgtggccacttttggagct
ggacctgttagcaattcacagcaattaagaccaaatttaacccatagcatggcaagcatg
ccagcacagagaacgtcgaatgtaatgatcacatccagcacaacagcaccaaactgggcc
tctcaagaagcaacaaccaaacaacaggaagccttgaagtccacggcagtccgcttcccc
acgggtacacctgcagcctatactccaaaccagtcattgcaacaggcagtgggcagccag
cagttttcccagaggccagtggttcctcctaaccagttaacaccagcagtgcagatgaga
cccatgaaccaattgagccaaacattaaatggacaaaccatgggtccactcagaagtctg
aacctcagacccagtcagctaagcacacaaattttgcctaatctgaaccagtcaggaaca
gggttgagtcagtcgaggacaggcataagccagccaccatccctgacaccaggcagtttc
ccgtcacccaaccaaagttccagggcttttcaaggaactgaccatggcagtgacttagct
tttgactttctcaaccaacaaactgataacttgggccctgccctcaacagcgatgctgat
ttcattgattctttattgaagacagagcctggtaacgatgactggatgaaagacatcaat
cttgatgaaatcttggggaacaactcctaa

KEGG   Ursus arctos horribilis: 113261557
Entry
113261557         CDS       T05909                                 

Gene name
MAML1
Definition
(RefSeq) mastermind-like protein 1
  KO
K06061  mastermind
Organism
uah  Ursus arctos horribilis
Pathway
uah04330  Notch signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    113261557 (MAML1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113261557 (MAML1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113261557 (MAML1)
SSDB
Motif
Pfam: MamL-1
Other DBs
NCBI-GeneID: 113261557
NCBI-ProteinID: XP_026363503
UniProt: A0A3Q7WPG5
LinkDB
Position
Unknown
AA seq 1027 aa
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALH
QRCIQAKAKRAGKHRQPPAPAPAAAPAPAPAAAPASAAPASAPRLDAADGPEHGRPVAHL
HDTVKRNLDSTTSPQNGEQQNGYGDLFPGHKKTRREAPLGVAVTSNGLPPASPLGQPDKP
GPEVLQASGKHALGLDSISKKCLVDSSLHLNGGSTPGEPFPLSLTKELKQEPVDDLPCMI
TGAGGSISQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSAT
QTPLAQDINIKTEFSPAAFEQEQLGSPQVRAGSAGQTFMGPSGGPVSTESPSLGGAQPLF
HASGQPGADNPSPSLMPASAQAQNAQRALSSVVLPGPGPGGASELSSAHQLQQIAAKQKR
EQMLQNPQQATPAPAPGQMSTWPQTGPSHSPLTVPYPLEKPASPPGYKQDFTNSKLLMMP
GVSKSSPRPGGPYLQASHVNLPSHPPPSNLSQNAVTNQASVLDYGNTKPLSHYKADCGQG
GPAAGQSKTALMAYLPQQLPHMSNEQNSLFMMKPKPGNMPFRSLVPPSQEQTPPSVPVAA
PAAGVGSQQPAASVASTRSSAPYLSSQQQAAVMKQHHLLLDQQKQREQQQKHLQQQQFLQ
RQQHLLAEQEKQQFQRHLTRPPPQYQDPTQSTFPQQVGQFTGSSAAVPGMNSLGPSNSSC
PRGFPQAGNLMPMGPGHTSVSSLPSNSGQQDRGVAQFTGSQSLPQSGLYGMASGITQIVA
QPPPQATNGHAHIARQTGVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNSGLTKPQVPRV
SAAMGGQNPSWQHQGLPNLSGQTPGSNTVSAFTAASSFHMQQAHLKMSSPQFSQAMPSRP
MAPMSSAGAAGSMLPPVSAQQRTSAPAPAPPQGAPQPGLPGLNPGGPELGAFSQSPAPPM
GGRAGLHCSQAYPVRTAGQELPFAYSGQPGGSGLASMAGDADLIDSLLKNRTSEEWMNDL
DDLLGPQ
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggtgctgcccacctgccccatggcggagttcgcgctgccgcggcacagcgcggtcatg
gagcgcctccgccggcgcatcgagctgtgccggcgccaccacagcacctgcgaggcccgc
tacgaggccgtgtcgcccgagcgcctggagctcgagcgccagcacaccttcgccctgcac
cagcgctgcatccaggccaaagccaagcgcgccggcaagcaccggcagccacccgccccg
gccccggccgccgccccggctccggcgcccgccgccgccccggcatccgccgcgccggcc
tcggccccgcgtctcgacgcggccgacggccccgagcacggccgccccgtcgcgcatctc
cacgatacggtgaagaggaacctcgatagcaccacctcccctcagaatggcgagcagcag
aacggctacggagacctcttccctggacacaagaagacccggcgagaggccccactggga
gtagccgtcacatccaacggcctgcccccggcctctcccctggggcagcctgacaagcct
ggccccgaggtgctgcaggccagcgggaagcacgccctggggctggactccatcagtaag
aagtgtctggtcgactccagcctccacttgaacgggggcagcacccccggcgagccgttt
cccctgagcctgactaaagagctgaagcaggagcccgttgatgacctgccttgcatgatc
acgggggccgggggctccatatctcagagcaacctcatgcctgacctcaacctgaacgag
caggagtggaaggagctcatcgaggagctgaacaggtcagtgcccgatgaagacatgaag
gatctgtttaatgaggacttcgaggagaagaaggacccagagtcgtctgggtcggccaca
cagaccccgttggcacaggacattaatattaagacagaattctctccagccgcctttgaa
caagaacagttaggctctccacaagtgagggctgggtctgcaggacagacctttatgggg
ccttcgggtggccccgtgagcacagagtcacccagcctggggggcgctcagcctctgttc
cacgcctccggtcagccgggggccgacaatcccagtcccagcctgatgccggcatcagcc
caggcccagaacgcacagagagccctctccagcgtggtgctgcccggcccgggcccggga
ggggcgtcggagctgtcctctgcccaccagctgcagcagatcgctgccaagcagaagcgc
gagcagatgctccagaacccgcagcaggccacccctgcgccagccccgggccagatgtcc
acgtggccgcagacaggcccctcccacagccccctaaccgtcccctatcccctggagaag
cctgccagccctcccggctacaagcaagacttcaccaactccaaactgctcatgatgccc
ggtgtgagcaagagctccccgcggcccgggggcccctacctccaggccagccacgtgaac
ctgccgagtcacccgccgcccagtaacttgagccagaacgccgtgactaaccaggcctca
gtgctggactacggcaacaccaaacccctgtcccattacaaagccgactgtgggcagggc
ggccccgcggccggccagagcaagaccgccctcatggcttaccttccccagcagctgcct
catatgagcaatgagcagaactccttgttcatgatgaaaccaaagccagggaatatgccc
ttccgatcactggttccacccagccaggagcagaccccgcccagcgtccccgtggctgcc
ccggctgccggggtggggagccagcagcccgctgcgtccgtggccagcacccgcagcagc
gccccctatctgagcagccagcagcaggcggcggtcatgaagcagcatcacttgcttttg
gaccaacagaaacagcgggagcagcagcaaaagcatctgcagcaacagcagttcctgcag
aggcagcagcaccttctggcagaacaggagaagcagcagtttcagcgccacctgacgcgc
ccgcctccccagtaccaagacccaacccagagcaccttcccccagcaggtgggacagttc
acagggtcctctgctgctgtgcctggcatgaacagcttgggcccatctaactccagctgt
cctcgagggttccctcaggccgggaatctgatgccaatgggccccggacacacttcggtt
tcctctctcccctccaactcaggccagcaggaccggggtgtggctcagttcactggctcc
cagagcctgccgcagagtggtctctatggcatggcctccggcatcacgcagatcgttgcc
cagcctccgccacaggccaccaacggacatgcccacatcgcacggcagaccggcgtgggc
cagaacacctcggtctccgctgcctatgggcagaactctctgggcagctctggcctctcc
caacagcacaacaaggggaccctgaactctggcttaaccaagccacaggtcccgagggtg
tcagccgctatgggaggccagaacccctcgtggcaacatcagggcctgccgaacttgagt
ggccagaccccagggagcaacaccgtgagcgcgttcacggcagcctccagtttccacatg
cagcaggcccacctgaaaatgtccagcccccagttctcccaggcaatgcccagcaggccc
atggcccccatgagctcggcaggtgcggcgggctccatgctgcccccggtgagcgcgcag
cagaggaccagtgcccccgccccagcacctccccagggagccccacagccaggcttgccg
ggcctgaaccccggcgggcctgagctgggggccttcagccagagcccggcaccaccaatg
gggggccgggcgggactgcactgctctcaggcctaccctgtgcggaccgcgggccaggag
ctgccctttgcctacagcgggcagccaggtggcagcgggctggccagcatggccggagat
gccgacctgatcgactccctgctgaagaacaggacttcggaagagtggatgaatgatttg
gacgaccttttagggcctcagtaa

DBGET integrated database retrieval system