KEGG   Ursus arctos horribilis: 113255769
Entry
113255769         CDS       T05909                                 

Gene name
TLR2
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04151  PI3K-Akt signaling pathway
uah04620  Toll-like receptor signaling pathway
uah05132  Salmonella infection
uah05134  Legionellosis
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113255769 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113255769 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113255769 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113255769 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113255769 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113255769 (TLR2)
   05321 Inflammatory bowel disease (IBD)
    113255769 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113255769 (TLR2)
   05134 Legionellosis
    113255769 (TLR2)
   05152 Tuberculosis
    113255769 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113255769 (TLR2)
   05162 Measles
    113255769 (TLR2)
   05161 Hepatitis B
    113255769 (TLR2)
   05168 Herpes simplex virus 1 infection
    113255769 (TLR2)
   05169 Epstein-Barr virus infection
    113255769 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113255769 (TLR2)
   05144 Malaria
    113255769 (TLR2)
   05145 Toxoplasmosis
    113255769 (TLR2)
   05140 Leishmaniasis
    113255769 (TLR2)
   05142 Chagas disease (American trypanosomiasis)
    113255769 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113255769 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113255769 (TLR2)
   04054 Pattern recognition receptors [BR:uah04054]
    113255769 (TLR2)
   04090 CD molecules [BR:uah04090]
    113255769 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255769 (TLR2)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    113255769 (TLR2)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   113255769 (TLR2)
Pattern recognition receptors [BR:uah04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   113255769 (TLR2)
CD molecules [BR:uah04090]
 Proteins
  113255769 (TLR2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Hyaluronan
  Cell surface receptors
   113255769 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_1 LRR_5 LRR_9 LRRCT
Other DBs
NCBI-GeneID: 113255769
NCBI-ProteinID: XP_026355287
UniProt: A0A3Q7WY23
LinkDB
Position
Unknown
AA seq 785 aa
MSRVLWTVWVLGAVTNLSKEEASDQAASLSCDPTGVCDGRSRSLNSMPSGLTAAVRSLDL
SNNEITYLGNGDLRGCVNLEALNLGSNGINTIEEDSFFSLRRLEHLDLSYNLLSNLSSSW
FRPLSSLKFLNLLGNLYKSLGETPLFSQLMNLRILKVGNIYSFTELQEKDFAGLTFLEEL
EIDASNLQRYEPKTLKSIQNISHLALRMKQPVFLLEIFADLSSSLKHLELRDTHLNTFRF
SKASISETNTLITKWTFRKVKITDGSFSEVVKLLNYVSGVLEVEFEDCTLDGLGDFNIAD
MDKIKNIGGIETLTVRRLYIPYFYSFYDMSSIYSLTEDVKRVTVESSKVFLVPCSLSQHL
KSLEYLDLSDNLMVEEYLGNSACEHAWPLLQTLTLRQNRLKSLEKTGETLLTLKNLMNLD
ISKNNFVSMPETCQWPEKLKYLNLSNTRINSVTRCIPWTLEILDISNNVLESFSLVLPQL
KELYISRNKLKTLPDASFLPMLRVMRISRNTISTFSKAQLDSFHTLKALEAGGNNFLCSC
EFLSFTQGQQALAQILTDWPENYLCDSPFYVRGQRVRDTRLPVSECHRAALVSAVCSVLF
LLIVLTGVLCHRFHGLWYLKMMWAWLQAKRKPRKAPAGDVCYDAFVSYSERDSYWVENLM
VQELEHFNPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDF
SHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPTDETQQEGFWLNLR
TAIRS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgtcacgtgttttgtggacagtatgggtgttgggggctgtaaccaacctctccaaagaa
gaggcctctgatcaggctgcttctctgtcctgtgaccccactggtgtctgcgatggccgc
tccagatctttaaactccatgccctcagggctcacggcagctgtgaggagccttgacctc
tccaacaacgagatcacctaccttggcaacggtgacctgcggggctgtgtgaacctcgag
gctttgaacctggggtctaatggaattaacacaatagaggaagattcttttttttccctg
cggcgtcttgaacatttggacttatcctataatctcttatctaacttatcatcctcctgg
ttcaggcccctttcttccctgaagttcttaaacttactgggaaatctttacaaatcactc
ggggaaacacctcttttttctcagctcatgaatttgcgaattctgaaagtaggaaatatt
tacagcttcactgagcttcaggaaaaggattttgctgggctcacttttctcgaggaactt
gagattgatgcttccaatctccagaggtatgagccaaagactttgaagtcaattcagaac
atcagtcacctggctcttcgtatgaagcagcctgttttcctgctggagatttttgcagat
ctttcaagttccttgaaacatttagaactgagagatactcatttgaacactttccgtttt
tcaaaagcatccatcagtgaaacaaatacgttgattacaaagtggacgtttagaaaagtg
aaaatcaccgatggaagttttagcgaagttgtgaaactgctgaattatgtttctggagtg
ttagaagtcgagtttgaggactgtaccctggatgggctgggtgattttaacatagccgat
atggacaaaattaaaaatataggtgggatagagacattaacagtacggaggttgtatatt
ccatacttttactcattttatgatatgagtagtatctattcacttacggaagacgttaaa
cgagtcacagtagaaagcagtaaggttttcctggttccttgctcactttcacaacattta
aaatcactagaatatttggatctcagtgacaatttaatggttgaagaatacttgggaaac
tcagcctgtgagcacgcctggcccctcctgcaaaccttaactttaaggcaaaaccgtttg
aaatcattagaaaaaaccggagaaacgttgcttactctgaaaaacctgatgaaccttgat
attagtaagaataattttgtttctatgcctgaaacttgtcagtggccagagaagttgaaa
tacttgaacttatccaacacgagaataaatagtgtaacccgttgcatcccctggacactg
gaaattttagatattagcaataacgttctcgagtcattttccctggttttgccacaactc
aaagaactttacatttccagaaataagttgaagactctaccggatgcctccttcttaccc
atgttacgagtcatgagaattagcagaaatacaataagtactttctctaaggcgcagctg
gattcttttcacacactgaaggccttggaagccggcggtaacaatttcctttgctcttgt
gaattcctgtctttcactcaagggcagcaagcactggcccagatcctgaccgactggcca
gagaactacctgtgtgactctccattctacgtgcgcggccagcgggttcgggacacgcgt
ctcccggtctctgaatgccaccgggcagctctggtgtccgccgtgtgctctgtcctcttc
ctgctgattgtgctcacgggggtcctgtgccaccgcttccacgggctgtggtacctgaaa
atgatgtgggcctggctccaggccaagaggaagcccaggaaagcccccgccggggacgtc
tgctatgatgcctttgtgtcctacagtgagcgcgattcctactgggtggagaacctgatg
gtccaggagctggagcacttcaaccctcccttcaagctgtgtctgcataagcgggacttt
gttcccggcaaatggatcattgacaacatcatcgactccatcgagaagagccacaagacc
atctttgtgctgtcggaaaactttgtgaagagtgagtggtgcaagtatgagctggacttc
tcccattttcgcctctttgatgagaacaatgatgccgccattctcattcttctggaaccc
attgagaaaaaggcaattccccagcgtttctgtaagctgaggaagataatgaacaccaag
acctacctggagtggcccaccgatgaaactcagcaggaagggttttggttaaatttgaga
acagcaataaggtcctag

KEGG   Ursus arctos horribilis: 113262895
Entry
113262895         CDS       T05909                                 

Gene name
TLR5
Definition
(RefSeq) toll-like receptor 5 isoform X1
  KO
K10168  toll-like receptor 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04620  Toll-like receptor signaling pathway
uah05132  Salmonella infection
uah05134  Legionellosis
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113262895 (TLR5)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113262895 (TLR5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113262895 (TLR5)
   05134 Legionellosis
    113262895 (TLR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:uah04054]
    113262895 (TLR5)
Pattern recognition receptors [BR:uah04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   113262895 (TLR5)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 113262895
NCBI-ProteinID: XP_026365260
UniProt: A0A3Q7XQQ8
LinkDB
Position
Unknown
AA seq 883 aa
MRPGHERQDPSPAGAGLGTQARRRIMGGHLDLLFGVIIAASPVLAMPSCASDGQRALYRS
CNLTQVPPVPSTTQVLLLSFNYIRTVTATSFPFLEQLQLLELGTQFTPFTIGREAFRNLP
NLRVLDLGNSQVDFLHPDAFQGLPHLLELRLFYCGLSDTILKDGYFRNLESLSRLDLSKN
EIRSLKLHPSFWELNSLKSIDFSLNQIAIVCEQELQPLQGKTLSLFNLAANHLYSRVSVD
WGACMNPFTDMVLETLDVSGNGWTADITGNFSRAISGSRISSLVLAHHIMGPGFGFQNIR
DPDRDTFAGLAGSAVLQLDLSHGFIFSLNFRLFEALKALKLLNLAHNKINRIAGEAFYGL
DSLQVLNMSYNLLGELYNSDFYGLPQVAYIDLQNNHIGIIQDQTFRFLKTLHTLDLRDNA
LKTISFLPSIDTIFLSSNKLVTLPNMRLKANFIHLSENRLEDLDDLYFLLQVPDLQVLIL
NQNRFSSCSRAHGPTGSRSLEKLFLGGNMLQLAWETGFCWDVFKGLSRLQILYLNNNYLT
FLPPGALSDLTALRGLDLNSNRLTALAPGDLPANLEVLDVSRNQLLSLDPDLFASLRAVD
ITHNRFICECDLRPLITWLNQTNVTVLGSRADIYCMYPNELTGTPLSSVSMEGCDEEEVL
KVIKFSLFISSTVTLTLFLVTILVVTKLRGLCFICYRAAHRLLPTVYAERCESDTYKYDA
YLCFSGRDFEWVQRALLRHLDAQYSDQNRFNLCFEERDFVPGREHIANIQDAVWGSRKVV
CLVSRHFLRDGWCLEAFTYAQNRCVSDLDGALILVIVGSLSQYELMKHQCIRGFVRKRQY
LRWPEDLQDVGWFLHTLSQHILKKGKDAKRDGSIPLQTVAAIS
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgcgccccggacacgagaggcaggacccctcaccagcaggtgcagggctggggacacaa
gccagacgcaggatcatgggaggccacctggaccttctgttcggggtgattattgcggcc
agccctgtgcttgcgatgccttcctgcgcctctgacggtcagagggccttgtatcgctcc
tgcaacctcacccaggtgccgccggtccccagcaccacccaggtcctcctgctcagcttc
aactatatccggactgtcacggccacgtccttccccttcctggagcagctgcagctgctg
gagctcgggactcagtttacccccttcaccatcggcagagaagccttcagaaacctgccc
aacctgagggtcttggacctgggcaatagtcaggtggatttcctgcatcccgatgctttt
caggggctgccccacctgcttgaactaagactcttctactgtggtctgtctgatactata
ttaaaagatggttatttcagaaacttagagtctttgtctcgcctggacctgtccaaaaat
gagattcgtagccttaagcttcatccttcgttctgggaattgaattccctgaagtccatt
gatttttccctcaaccagatcgccatcgtgtgtgaacaggagctccagccgctccaaggg
aagaccctctccctgttcaacctcgctgccaatcacctgtacagtagggtctccgtggac
tggggcgcgtgcatgaacccgttcacagacatggtcctggaaaccctggacgtttctggc
aatggctggacggcggacatcacagggaacttcagcagggccatcagcgggagccggatc
tcctcgctggttctggcccaccacatcatggggcccgggtttggcttccagaacatcagg
gaccccgaccgggacacgtttgccggcctggccgggagcgcggtgctgcagctggatctg
tcccatggctttatcttctccctgaacttccgactctttgaggccctcaaggccttgaag
ctcctgaacctggcccacaacaagataaacaggattgcaggagaagcattttatggcctt
gacagcctccaggttcttaacatgtcatataaccttctgggggagctttacaattccgat
ttctatggactccctcaggtagcctatattgatcttcaaaacaatcatattgggatcatt
caggaccagaccttcaggttcctgaaaacattacacaccttggatctccgggacaatgct
cttaaaacaatttctttcctgccaagcatagacactatcttcttgagtagcaataaactg
gtgaccttgccgaacatgagacttaaagccaacttcatccacttatcagagaacaggcta
gaagatctggacgatctctacttcctcctccaggtccctgacctccaggtcctcattctg
aatcaaaatcgcttttcctcttgcagccgagctcacggccctacaggcagccgcagctta
gaaaagcttttccttggaggaaacatgttgcagcttgcctgggaaaccggcttctgctgg
gatgtgttcaaggggctctcccggctccagatcctttacctgaacaacaactacttgacc
ttcctcccgccgggggcacttagtgatctgactgcgctgaggggcctcgacctcaactcc
aacaggctgacagctcttgctcctggtgacttgcctgcgaacctggaggtgctggacgtg
tccagaaaccagctcctgtccctggaccccgacttgtttgcatccctcagagccgtggac
ataacgcacaacaggttcatctgtgagtgtgacctccgtcctctcatcacttggctcaac
cagaccaacgtcactgtacttgggtctcgtgcagacatctactgcatgtaccccaacgag
ctcacggggacccccctctcctctgtgtccatggagggctgcgatgaggaggaggtcttg
aaggtcataaagttttcccttttcatctcatccacggtcactctgactctgttcctcgtg
accatccttgtggtcaccaagctccggggcctttgtttcatctgttacagggcggcccac
agactgctgcccacggtctacgctgagcgctgcgagtccgacacgtacaaatacgatgcc
tacctgtgcttcagcggcagagacttcgagtgggtgcagagggctctgctcagacacctg
gatgctcagtacagcgaccagaacagattcaacctgtgctttgaagaaagagacttcgta
ccggggcgggagcacatcgccaacatccaggatgccgtgtggggcagcaggaaggtggtc
tgcctcgtgagcagacacttcctccgagacggctggtgcctggaagccttcacttacgcc
cagaacaggtgcgtgtctgacctggacggcgccctcatcctggtgatcgtcgggtcccta
tcccagtatgagctgatgaagcatcagtgcatcagagggttcgtgcggaaacgacagtac
ttgaggtggcccgaggatctccaggatgttggctggttccttcacacactctctcagcac
attctgaagaaagggaaggacgccaagagggacggtagcatcccattgcaaactgtggcg
gccatctcctag

KEGG   Ursus arctos horribilis: 113266343
Entry
113266343         CDS       T05909                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4
  KO
K10160  toll-like receptor 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04064  NF-kappa B signaling pathway
uah04066  HIF-1 signaling pathway
uah04145  Phagosome
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113266343 (TLR4)
   04066 HIF-1 signaling pathway
    113266343 (TLR4)
   04151 PI3K-Akt signaling pathway
    113266343 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113266343 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    113266343 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113266343 (TLR4)
   04621 NOD-like receptor signaling pathway
    113266343 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113266343 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113266343 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113266343 (TLR4)
   05321 Inflammatory bowel disease (IBD)
    113266343 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113266343 (TLR4)
   05135 Yersinia infection
    113266343 (TLR4)
   05133 Pertussis
    113266343 (TLR4)
   05134 Legionellosis
    113266343 (TLR4)
   05152 Tuberculosis
    113266343 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113266343 (TLR4)
   05162 Measles
    113266343 (TLR4)
   05164 Influenza A
    113266343 (TLR4)
   05161 Hepatitis B
    113266343 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113266343 (TLR4)
   05144 Malaria
    113266343 (TLR4)
   05145 Toxoplasmosis
    113266343 (TLR4)
   05140 Leishmaniasis
    113266343 (TLR4)
   05142 Chagas disease (American trypanosomiasis)
    113266343 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113266343 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:uah04054]
    113266343 (TLR4)
   04090 CD molecules [BR:uah04090]
    113266343 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113266343 (TLR4)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    113266343 (TLR4)
Pattern recognition receptors [BR:uah04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   113266343 (TLR4)
CD molecules [BR:uah04090]
 Proteins
  113266343 (TLR4)
Glycosaminoglycan binding proteins [BR:uah00536]
 Hyaluronan
  Cell surface receptors
   113266343 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_1 LRR_5 LRR_9 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 113266343
NCBI-ProteinID: XP_026369642
UniProt: A0A3Q7Y0J4
LinkDB
Position
Unknown
AA seq 833 aa
MMSPTRLAGMLIPAMAFLSFLRPESWEPCVQVVPNITYKCMELNLDKIPNNIPTSTKELD
LSFNPLRHLDSHSFSNFPELQVLDLSRCEIRIIEDDAYQGLNHLSILILTGNPIQELFPG
AFSGLSNLQTLVVVETNVQSLEDFPIGHLKTLKELNVAHNLIHSFKLPEYFSNMPNLEYL
DLSNNKIQNIYHKDLQVLRQMPLLNLSLDLSLNPLYFIQPGAFKEIKLHELTLRSNFNST
HVMKTCIQGLAGLKIHQLVLGEFKNERKLESFDKSLLEGLCDLTIEKFRIAYFDEFSKDT
TDLFNCLGNVSTISLVHLFLNRPRYLPKNLRWQRLEMVNCGFEEFPTWGLDSLKEFVFTA
NKGVNTFTEMNPNSLEFLDLSRNGLSFKGCCSHSELGTTRLKHLDLSFNDIITMSSNFLG
LEQLEYLDFQHSNLKQASDFSVFLSLRNLRYLDISYTHTQVVFHGIFDGLVRLQVLKMAG
NSFQDNFLPNIFKDLTNLTILDLSKCQLERVSQVAFGSLPKLQLINMSHNNLLSLDTLPY
EPLLSLQILDYSFNRIVASKERERQHFPSNLVSLNLTQNDFACVCEHQNFLQWVKDHRQL
LVEVEEMVCAKPLDMQGMPVLSFRNATCQRSKTIITVSVFTVLMVSLVAVLVYKFYFHLM
LLAGCKKYSKGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLL
RQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKQWSPEGTADAENS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgatgtctcctacccgcctggctgggatgctgatcccagccatggccttcctctccttc
ctgagacccgagagctgggagccttgtgtgcaggtggttcctaacattacttacaaatgc
atggaactgaatctcgacaaaattcccaacaacatccccacgtcaaccaaggaactggac
ctgagctttaaccccctgaggcatttagacagccatagcttctccaacttcccagaactt
caggtgttggatttatccaggtgtgaaattcggataattgaagatgatgcgtatcagggc
ctaaaccacctctccatcttgatattgacaggaaaccctatccaggagttattcccagga
gccttttctggactctcaaatttacagacgctggtggtcgtggagacaaatgtacaatct
ctagaggacttccccattggacatctcaaaaccttgaaggagcttaatgtagctcacaat
cttatccattccttcaagttacctgaatatttttctaacatgcccaacctggagtacttg
gatctttccaataacaagatccaaaatatttatcataaagacttgcaggttctacgtcaa
atgcctctactcaacctttctttagacttgtccctgaaccctttatactttatccaacca
ggtgcctttaaagaaattaaactccatgaactgactttgagaagtaattttaatagtaca
catgtaatgaaaacttgtattcaaggtctggctggtttaaagatccatcagttggttctg
ggagaatttaaaaatgaaaggaagttggaaagctttgataaatctctcctggagggactg
tgtgatttgaccattgaaaaattccggatagcatactttgatgagttctcaaaggatact
actgacttatttaattgtttgggaaatgtttctacaatttctctggtgcatctgttttta
aacaggccaagataccttcctaaaaatctcagatggcaacggttggaaatggttaactgt
ggatttgaagaatttcccacgtgggggctggactctctcaaggagtttgttttcactgcc
aacaaaggcgtgaacacttttactgagatgaacccgaacagccttgagtttctagatctc
agtagaaatggcctgagttttaagggttgctgttctcactctgaattggggacaaccaga
ctgaagcatttagatctgagcttcaatgatattattaccatgagttcaaacttcttgggc
ttagaacaactagaatatctagatttccagcattccaatttgaaacaggctagtgatttt
tcagtattcctatccctcagaaacctccgttaccttgatatttcttatactcacacccaa
gttgtcttccacggcatttttgatggcttggtcagactccaagtcttgaaaatggctggt
aattcttttcaggacaacttccttccaaatattttcaaagacctgactaacttgaccatt
ctagatctctctaagtgtcagctggaacgggtgtcccaggtagcatttggttcacttccg
aaacttcagttgataaatatgagtcacaacaatctcctgtcattggatacactcccttat
gaacctctcctctccctccaaattctggattacagttttaatcgaatagtggcctccaaa
gagcgagaacgacagcattttccaagtaatctagtttccttaaatcttactcagaatgac
tttgcttgtgtttgtgaacaccagaacttcctgcagtgggtcaaggaccacaggcagctc
ttggtggaagttgaagaaatggtgtgtgcaaaacctttagacatgcagggcatgcccgtg
ctgagttttaggaatgccacctgtcagaggagtaagactatcattactgtgtcggtgttc
actgtactcatggtttctctggtagcagttttggtgtataagttctatttccacctgatg
cttcttgctggctgcaaaaagtacagcaaaggcgaaagcacttatgatgccttcgttatc
tactcaagtcaagatgaagactgggtaaggaatgaactggtaaagaacttggaagagggg
gtgcccccctttcagctctgccttcactatagagacttcattcctggtgtggccattgct
gccaacatcatccaggaaggtttccacaaaagccggaaggttattgttgtggtgtcccaa
cacttcatccagagtcggtggtgtatctttgagtatgagattgcccagacctggcagttt
cttagtagtcgtgccggcatcatcttcattgttctgcagaaggtggagaagtccctgctg
cggcagcaggtggagctgtatcggcttcttagcaggaacacttacctagagtgggaagac
agtgtcctggggcggcacatcttctggagacgactccgaaaagccttgctggatggtaaa
cagtggagtccagaaggaacagcagatgcagaaaacagctag

DBGET integrated database retrieval system