KEGG   Ursus arctos horribilis: 113256295
Entry
113256295         CDS       T05909                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04120  Ubiquitin mediated proteolysis
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04625  C-type lectin receptor signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113256295 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113256295 (MDM2)
   04151 PI3K-Akt signaling pathway
    113256295 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113256295 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    113256295 (MDM2)
   04115 p53 signaling pathway
    113256295 (MDM2)
   04218 Cellular senescence
    113256295 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113256295 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113256295 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256295 (MDM2)
   05202 Transcriptional misregulation in cancer
    113256295 (MDM2)
   05206 MicroRNAs in cancer
    113256295 (MDM2)
   05205 Proteoglycans in cancer
    113256295 (MDM2)
   05203 Viral carcinogenesis
    113256295 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    113256295 (MDM2)
   05220 Chronic myeloid leukemia
    113256295 (MDM2)
   05218 Melanoma
    113256295 (MDM2)
   05219 Bladder cancer
    113256295 (MDM2)
   05215 Prostate cancer
    113256295 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113256295 (MDM2)
   05169 Epstein-Barr virus infection
    113256295 (MDM2)
   05165 Human papillomavirus infection
    113256295 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113256295 (MDM2)
   01522 Endocrine resistance
    113256295 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113256295 (MDM2)
   04121 Ubiquitin system [BR:uah04121]
    113256295 (MDM2)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113256295 (MDM2)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    113256295 (MDM2)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    113256295 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 113256295
NCBI-ProteinID: XP_026355857
UniProt: A0A3Q7WZP8
LinkDB
Position
Unknown
AA seq 487 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKEPVQELQEEKPSSSDLVSRPSTSSRRRAISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKIPEKAKLENSTQVEEGFDVPDCKK
TAVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQDKEE
VVESSFPLNAIEPCVICQGRPKNGCIVHGRTGHLMACFTCAKKLKKRNKPCPVCRQPIQM
IVLTYFP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaggagaccctggttagaccaaagcctttgcttttgaagttgttaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggagccggtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccgtctacctcatct
agaaggagagcaattagtgagacagaagaacattcagatgaattacctggtgaacggcag
agaaagcgccacaaatctgatagtatttccctgtcctttgatgaaagccttgctctgtgt
gtaataagggagatatgctgtgaaagaagcagtagcagtgaatcaacagggacaccatca
aatccggatcttgatgctggtgtaagtgagcattcaggtgactggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattacagt
cttagtgaagaagggcaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgataccgattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaac
agatgttgggcccttcgtgagaactggcttcctgaagataaagggaaaatacctgagaaa
gccaaactagaaaactcaacacaagtagaagagggctttgatgtccctgattgtaaaaaa
actgcagtgaatgattccagagaatcatgtgctgaggaaaatgatgataaaatcacacaa
gcctcccaatcccaagaaagtgaggattattctcagccatcaacttctaacagcatcatt
tacagcagccaagaagatgtcaaagagtttgagagggaggaaacacaagacaaagaagag
gttgtggaatctagttttcccctgaatgccattgaaccttgtgtgatttgccagggtcga
cctaaaaacggttgcattgttcatggcagaacaggacatcttatggcgtgctttacgtgt
gcaaagaagctcaagaaaaggaataagccctgcccagtatgtagacagccaattcaaatg
attgtgctaacttatttcccctag

DBGET integrated database retrieval system