KEGG   Ursus arctos horribilis: 113256304Help
Entry
113256304         CDS       T05909                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah03050  Proteasome
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04612  Antigen processing and presentation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    113256304 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113256304 (IFNG)
   04630 Jak-STAT signaling pathway
    113256304 (IFNG)
   04066 HIF-1 signaling pathway
    113256304 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256304 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113256304 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113256304 (IFNG)
   04612 Antigen processing and presentation
    113256304 (IFNG)
   04660 T cell receptor signaling pathway
    113256304 (IFNG)
   04658 Th1 and Th2 cell differentiation
    113256304 (IFNG)
   04659 Th17 cell differentiation
    113256304 (IFNG)
   04657 IL-17 signaling pathway
    113256304 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113256304 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256304 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113256304 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    113256304 (IFNG)
   05323 Rheumatoid arthritis
    113256304 (IFNG)
   05321 Inflammatory bowel disease (IBD)
    113256304 (IFNG)
   05330 Allograft rejection
    113256304 (IFNG)
   05332 Graft-versus-host disease
    113256304 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113256304 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113256304 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113256304 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    113256304 (IFNG)
   05160 Hepatitis C
    113256304 (IFNG)
   05168 Herpes simplex virus 1 infection
    113256304 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113256304 (IFNG)
   05144 Malaria
    113256304 (IFNG)
   05145 Toxoplasmosis
    113256304 (IFNG)
   05140 Leishmaniasis
    113256304 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    113256304 (IFNG)
   05143 African trypanosomiasis
    113256304 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:uah03051]
    113256304 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256304 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113256304 (IFNG)
Proteasome [BR:uah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113256304 (IFNG)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113256304 (IFNG)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113256304 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFN-gamma
Motif
Other DBs
NCBI-GeneID: 113256304
NCBI-ProteinID: XP_026355871
UniProt: A0A3Q7V3L2
LinkDB All DBs
Position
Unknown
AA seq 166 aa AA seqDB search
MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR
EESDKTIIQSQIVSFYLKLFENFKDNQVIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQ
IPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaattatacaagctatatcttagctttccagctttgtgtgattttgtgttcttctggc
tattactgtcaggccatgttttttaaagaaatagaaaacctgaaggaatattttaatgca
agtaatccagatgtagcagatggtggccctcttttcttagatattttgaagaactggaga
gaggagagtgacaaaacgatcattcaaagccaaatcgtctccttctacttgaaactgttc
gaaaactttaaagataaccaggtcattcaaaggagcatggacaccatcaaggaggacatg
cttttcaagttcttcaacagcagtaccagtaagcggagtgacttccttaagctgattcaa
attcccgtgaatgatatgcaggttcagcgcaaagcgataaatgaactcatcaaagtgatg
aatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgtttcga
ggccgcagagcatcgaaataa

DBGET integrated database retrieval system