KEGG   Ursus arctos horribilis: 113256394
Entry
113256394         CDS       T05909                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6 isoform X1
  KO
K11225  signal transducer and activator of transcription 6
Organism
uah  Ursus arctos horribilis
Pathway
uah04217  Necroptosis
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05161  Hepatitis B
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256394 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113256394 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113256394 (STAT6)
   04659 Th17 cell differentiation
    113256394 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256394 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113256394 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    113256394 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113256394 (STAT6)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113256394 (STAT6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 113256394
NCBI-ProteinID: XP_026355997
UniProt: A0A3Q7X051
LinkDB
Position
Unknown
AA seq 844 aa
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLSDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQASAGKQGEGSAILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFNTALQRLQHRVGETRLLREALQPGAEAGQVSLHSLIDAPANGTGPSEALA
KLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKARAVLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSMPQGPGTGAESTGEIINNTVALENSIPANCCSALF
KSLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTLE
PQMPTMVPAYDLGMAADSSMNMQLSPDMVSQVYPPHSHSIPSYQALSREDTLTAFPESHL
QMPPNLNQINLPFDQPHPQGLLPCPSQEHAVSTPEPLLCSDVTMAEDSCMNQSVGGFPQG
TWVGEDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGTQPLLQPSHYGQSGISMSHLDLRA
NPSW
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcctccggaaaaactgcagcggctctatgtc
gactttccccaacacctgcggcatctcctgagtgactggctcgagaaccagccctgggag
ttcctggtcggctcagacaccttctgctgcaacatggctagtgccctcctttccgccact
gttcagcgccttcaggcttcagctggaaagcagggggaggggagtgccatcttgcaacac
atcagcaccctggagagcatatatcaaagggaccccctgaagctggtggccacttttaga
caaatacttcaaggggagaaaaaagctgttatggaacagtttcgccacctcccgatgccc
ttccactggaagcaggaggaactgaagtttaacacagccctgcagaggctgcagcatcgg
gttggggaaactcgccttctccgagaggccctgcagccgggagctgaggctggccaagtg
tctctgcacagcttgatagatgctcctgccaatggaactgggccaagtgaggccctggcc
aagttgctgcaggagactgtgggggagctggaggctgcccaggccctggtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggtgcaccctttgaggagagc
ctggcaccactacaggagaggtgtgagagcctggtggacatttattcccagctgcagcag
gaggtgggggcagctggtggggagcttgagcccaaggcgagggcagtgctgattagccgg
ctggatgaagtcctgagaaccctcgtcaccagctctttcctggtggagaagcagcccccc
caagttctgaagactcagaccaagttccaggctggggttcgattcttactgggccttcgg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgactgagaagcaa
gcaagggagctgagcatgccccaggggcctgggactggagcagaaagcactggggaaatc
atcaacaacaccgtggcactggagaacagcattcctgccaactgctgctctgccctgttc
aagagcctgcttctgaagaaaatcaagcgctgtgagcggaagggcaccgagtctgtcacc
gaggagaagtgtgcggtgctcttctccaccagcttcacgctcggccccaacaaactcccc
atccagctccaggccctgtctctgccgctggtggtcattgtccacggcaaccaggacaac
aatgccaaagccaccatcttgtgggataatgccttctctgagatggaccgagtgcccttt
gtggtagctgagcgggtgccctgggagaagatgtgtgaaactctcaacctcaagttcatg
gctgaagtggggaccaatcgagggttactcccagagcacttcctcttcctagcccagaag
atcttcaatgacaacagcctcagcatggaggccttccagcaccgttctgtgtcctggtca
cagttcaacaaggagatcctgctgggtcgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaagcgctgtctccggagctactggtcagatcggctgatcattggc
ttcatcagcaaacagtacgtcactagccttcttctcaacgagcctgatggaacattcctc
cttcgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctatccattcgt
tcactgggagaccgaatccgggaccttgctcagctcaaaaacctctaccccaagaaaccc
aaggatgaagctttccggagccactacaagcctgaacagatgggtaaggacggcaggggt
tacgtcccagctaccattaagatgactgtggaaagggaccagccacttcctaccctggag
ccccaaatgcctaccatggtgcccgcttacgatcttggaatggccgctgattcctccatg
aacatgcagctcagcccagatatggtgtcccaggtgtacccaccgcactctcactccatc
ccctcgtatcaagccctctcccgggaagacacattgacagccttcccagaatctcacctg
cagatgccccccaacctgaaccagatcaacctgccctttgaccaacctcaccctcagggc
ctgctcccatgcccatctcaggagcatgccgtgtccactcctgagcccctgctctgctca
gatgtgaccatggcagaagacagctgcatgaaccagtcggtgggagggttccctcagggc
acctgggtcggtgaagacatgttcccacccttgctgcctcctactgaacaggacctcacc
aagcttctcctggaggggcaaggggaatcagggggagggtccttgggcacccagcccctc
ttgcagccctcccactatgggcagtctgggatctcaatgtcccacctggacctaagggcc
aaccctagttggtga

DBGET integrated database retrieval system