KEGG   Ursus arctos horribilis: 113256419
Entry
113256419         CDS       T05909                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256419 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113256419 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113256419 (STAT2)
   04625 C-type lectin receptor signaling pathway
    113256419 (STAT2)
   04062 Chemokine signaling pathway
    113256419 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113256419 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256419 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    113256419 (STAT2)
   05164 Influenza A
    113256419 (STAT2)
   05161 Hepatitis B
    113256419 (STAT2)
   05160 Hepatitis C
    113256419 (STAT2)
   05168 Herpes simplex virus 1 infection
    113256419 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113256419 (STAT2)
   05169 Epstein-Barr virus infection
    113256419 (STAT2)
   05165 Human papillomavirus infection
    113256419 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113256419 (STAT2)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113256419 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 113256419
NCBI-ProteinID: XP_026356044
UniProt: A0A3Q7WPB4
LinkDB
Position
Unknown
AA seq 854 aa
MAQWEMLQNLSSPFQDRLHQLYSDSLLPMDIRQCLAVWIEDQNWQEAALGNDDSKATVLF
FHFLDQLNNECGRCSQDPDLLLLQHNLRKFSRDIQAFPQGPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPALEAPVESQQHEIESRILELKTMMEMLVKSISQLKDQQDVFCFRYKTQ
AQVKTLSLDPHQTRQRQLLQETLNELDRRRKEVLDATKALLGQLTTLVELLLPKLEEWKV
QQQKACVGAPLDAGLEQLEKWFTAGARLLFHLRQLLKELEGLSRLVSYKDDPLTTGVDLR
KAQVTELLQHLLQRAFVVETQPCMPQIPHRPLILKTGSKFIVQARLLVRLQEGNESLTAE
VSIDRNPPQSQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGCNKG
MLGVTEELHVISITVNYTYQGLKQELRTDTLPVVIISNMSQVSIAWASVLWFNLLSSNPQ
NQQFFSSPPKAPWSLLGPALSWQFSSYVGRGLDPDQLSMLRNKLFGQNSRTEGASLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERKLLKKTISGTFLL
RFSETSEGGITCSWVEHQDDDRVLIYSVQPFTKEVLQSLPLTKIIRHYQLLTDENIPENP
LCFLYPRIPRDEAFGHYYQEKVNLEERRKYLKHKLIVVSNRQVDELQQPPDLKLEPEAES
FELESGLAPLLQLEPGLELEPLLEAGLNLGPALEPLLEPALDVAQRVSEPDLGPELKLEP
ILDPASQAVPEPDLPHDLRHLNTEEMEIFRNSMKIEEIMPNGDPLFAGQNTVDEAYAFHP
SHFCTDGPLIPSDY
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaatctcagcagcccatttcaggaccggctgcaccag
ctgtactcagatagcctcctgccaatggacattcgacagtgcttagctgtctggattgaa
gaccagaactggcaggaggctgcactgggcaatgatgattccaaggctaccgtgctgttc
ttccacttcttggaccaactgaacaacgagtgtggccgctgcagccaggaccccgatctc
ttgttactacagcacaacttgcgaaaattctctcgggacattcaggcctttccccagggc
cctacccaattggctgagatgatctttaatctccttctggaagaaaaaagaattctgatc
caggcccagagggctcagttggagcaaggagagccagccctcgaagcacccgtagagagc
cagcagcatgagattgagtcccggatactggaattaaagactatgatggagatgctggtg
aaatccatctcccagctgaaagaccagcaggatgtcttctgcttccggtataagacccag
gcccaagtgaagacactctctttagacccccatcagacgagacagcggcagctgctgcag
gagactctcaatgaactggacagaaggagaaaggaggtgctggacgccaccaaagccttg
ctaggccaattaacaaccctcgttgagctactgctgcccaagttggaggaatggaaagtc
cagcagcagaaagcctgcgttggagcccctctggatgcagggttggaacagctggagaag
tggttcacagccggagccaggctgctgtttcacctgcgtcagctgttgaaggagctggag
ggactgagtcgcctggttagctataaggatgaccctctgaccaccggggtggacctgcgg
aaggcccaggtcacggagttgctacagcacctgctccagagggcctttgtggtagaaacc
cagccctgcatgccccaaattccccatcgacccctcatcctcaagactgggagcaagttc
attgtccaagcaaggctgctcgtgagactccaggaaggcaatgagtcactaacggcagaa
gtctccattgacaggaatcctcctcagtcacaaggcttccggaagttcaacattctaacc
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggcttaatttgggacttc
ggctatctgactctagtggagcaacgttcaggtggctcaggaaagggctgcaataaggga
atgctgggcgtgacagaggagctgcacgtcatcagcattacggtcaactacacctaccag
ggtctgaagcaggagctgagaacggacaccctccctgtggtgattatatctaacatgagc
caagtctccattgcctgggcctcggttctttggttcaatctgcttagctcaaacccccag
aatcagcagttcttctccagcccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctacgttggccgaggccttgacccagaccagctgagcatgctg
aggaacaagctgtttgggcagaactctaggactgagggtgcatcgttatcctgggctgac
ttcactaagcgagagagccctcctggcaagctaccattctggacatggttagacaaaatt
ctggagctggtgcatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagccggagccaggagcgcaagctgctgaagaagaccatctccggcaccttcctgctg
cgcttcagcgagacgtcggagggaggcattacctgctcctgggtggaacaccaggacgat
gatagggtgctcatctactctgtgcagcccttcaccaaggaagtgctgcagtctctcccg
ctgaccaaaatcattcgccactaccagctgctcacggacgagaacatccccgagaaccca
ctgtgcttcctctacccccggataccccgggatgaggctttcgggcactactaccaggag
aaagttaacctcgaggaacggaggaagtacctgaaacataagctcattgtggtctctaac
agacaggttgatgagctgcagcaaccaccggaccttaagctggagccagaagcggagtcg
tttgagctggagtcaggactggccccactgctacagctagagccaggcctggagttggag
ccactgctggaggcaggactgaatctggggccagccctggagcccctgctggagcccgca
ctggatgtggcacaaagagtgtcagagccagacttgggaccagagctgaagctggagcct
attctagaccccgcatcacaggcagtgccagagccagatttgccccatgatctgagacac
ttgaacaccgaggaaatggaaatcttcagaaacagtatgaagattgaagaaatcatgcca
aatggtgacccactgtttgctggacagaacaccgtggacgaggcttacgctttccatccc
agccatttctgcacggacgggcccttgattccttctgactactag

DBGET integrated database retrieval system