KEGG   Ursus arctos horribilis: 113256421
Entry
113256421         CDS       T05909                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05133  Pertussis
uah05152  Tuberculosis
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256421 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256421 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113256421 (IL23A)
   04659 Th17 cell differentiation
    113256421 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256421 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113256421 (IL23A)
   05321 Inflammatory bowel disease (IBD)
    113256421 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113256421 (IL23A)
   05152 Tuberculosis
    113256421 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256421 (IL23A)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113256421 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 113256421
NCBI-ProteinID: XP_026356047
UniProt: A0A3Q7X098
LinkDB
Position
Unknown
AA seq 190 aa
MLGSRAVMLLLLLLWGAQTRAVPAGGRPAWVQGQQLSQRLCTLAWSAHPPMGQVDLPREE
GDDETTDEVPRIQCGDGCDPQGLRDNSQFCLQRIHQGLVFYEKLLGSDIFTGEPSLLPDG
PVGQLHASLLGLRQLLQPEGHHRETEQTPSPSPSQPWQRLLLRFKILRSLQAFVAVAARV
FAHGAATLSP
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctggggagcagggctgtgatgctgcttctgctgctgctctggggggctcagacccgg
gctgtgcctgcgggcggtcgccctgcctgggttcagggccagcagctctcacagaggctc
tgcacgctggcctggagcgcacatccgccgatgggacaggtggacctaccaagagaagag
ggagatgacgagactacagatgaggtcccccgcatccagtgtggggatggctgtgatccc
caaggactcagagacaacagtcagttctgcttacaaaggatccaccagggcctggttttt
tatgagaagctgctgggctcagacattttcacaggggagccttctctacttcccgatggc
cctgtgggccagcttcacgcctccctcctgggccttaggcaacttttgcagcctgagggt
caccacagagagactgaacaaactccaagccccagccccagccagccatggcagcgcctc
cttctccgcttcaagatccttcgcagcctccaggcctttgtggctgtagctgctcgggtc
tttgcccacggagcagcaaccctgagcccctaa

DBGET integrated database retrieval system