KEGG   Ursus arctos horribilis: 113256526
Entry
113256526         CDS       T05909                                 

Gene name
XCR1
Definition
(RefSeq) chemokine XC receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256526 (XCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113256526 (XCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113256526 (XCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113256526 (XCR1)
   04050 Cytokine receptors [BR:uah04050]
    113256526 (XCR1)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    113256526 (XCR1)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  C Chemokine
   113256526 (XCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 113256526
NCBI-ProteinID: XP_026356141
UniProt: A0A3Q7V4E9
LinkDB
Position
Unknown
AA seq 331 aa
MEPSGTPESTTSFDYDYQSFLCESKTFTFATFSTTILYLLVFLLSLVGNSLVLWVLVKYE
SLESLTNVFILNLCLSDLVFSCLLPVWIMAYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVRPLSSLRVHTLQCRVLVTTAVWATSILSSIPDAVFHKVFSSGCDYSES
KWFLASVYQHNIFFLLSIGIILFCYVEILKTLFRSRSKRRPRTVRLIFTIVAAYFLSWAP
YNLVLFLQTLLKLGVIQSCKLSQQLDYALLICRNVAFSHCCFNPVLYVFVGVKFRRHLKS
LLRHFWLCRQQAASIPHHSTGAFNYEGPSFY
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagccctcaggcaccccagagtccaccacctcttttgattatgattatcagagcttt
ctgtgtgagagcaagaccttcacctttgccaccttcagcaccaccatcctgtacttgctg
gtgttcctcctcagcctggtgggcaacagcctggtgttgtgggtcctggtgaagtatgag
agcctggaatccctcaccaatgtcttcatcctcaacctgtgcctctcagatctggtgttc
tcctgcttgttgccagtgtggatcatggcgtaccactggggctgggtgctgggggatttc
ctctgcaagctcctcaacatgatcttctccatcagcctctatagcagcatcttcttcttg
accatcatgaccatccaccgctacctgtcagtggtgaggcccctctcatccctgcgtgtc
cacaccctccagtgccgtgtgctggtgaccacggccgtgtgggcaaccagcatcctgtcc
tccatccctgatgctgtcttccacaaggtgttttcttcaggctgtgactactcagaaagc
aagtggttcctagcctcggtctaccagcacaacatcttcttcctgctctccattgggatt
atcctgttctgctacgtggaaattctcaagaccctgttccgctcacggtccaaacggcgg
ccccgtacagtcaggctcatcttcaccatcgtggcagcctactttctcagctgggctccc
tacaacctggtcctgtttctgcagacacttctgaaacttggggtcatccagagctgcaag
ctcagccagcagctggattatgccttgctcatctgccgcaacgttgccttctcccactgc
tgcttcaacccagtgctctacgtttttgttggggtcaagttccgcagacatctcaaaagt
ctgctccggcacttctggctctgccggcagcaagcagccagcattccccatcactccaca
ggcgccttcaactacgagggtccctccttctattga

DBGET integrated database retrieval system