KEGG   Ursus arctos horribilis: 113256649
Entry
113256649         CDS       T05909                                 

Gene name
MX1
Definition
(RefSeq) interferon-induced GTP-binding protein Mx1
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
uah  Ursus arctos horribilis
Pathway
uah05160  Hepatitis C
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113256649 (MX1)
   05164 Influenza A
    113256649 (MX1)
   05160 Hepatitis C
    113256649 (MX1)
   05165 Human papillomavirus infection
    113256649 (MX1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16 AAA_29 AAA_21 CHDNT ABC_tran Cnd1
Other DBs
NCBI-GeneID: 113256649
NCBI-ProteinID: XP_026356256
UniProt: A0A3Q7W4X3
LinkDB
Position
Unknown
AA seq 660 aa
MVKSKGKITDSDPGSNQLLLNGLADEEEKNQDTEPKLSLCSQYEEKVRPCIDLIDSLRAL
GVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGNGIVTRCPLVLKLKKLLNEDEWRG
KVSYQDFEMEISDPSEVEVEINKAQDAIAGEGQGISHELITLEVSSPHVPDLTLIDLPGI
TRVAVGNQPADIGRQSKQLIRKYIFKQETINLVVVPCNVDIATTEALSMAQEVDPDGDRT
IGILTKPDLVDRGTESKVVDVAQNLVCHLKKGYMIVKCRGQQDIQDQVTLAEALQKERVF
FEDHPHFRVLLEEGRATVPCLADKLTSELISHICKTLPLLENQIKENHEKITEELQKYGS
DVPEDEHEKMFFLIDKINAFNHDINSLIEGEESVGEDESRLFTKIRTEFHKWSAVIEKRF
QKGYKAIYKQIEKFENRYRGRELPGFVNYKTFEIIIKQQIKELEEPAVDMLHTVTDMVQA
AFTDISKANFDEFFNLYRTTKSKIEDIKFELEKEAEKSIRLHFQMEQIVYCQDQVYQRAL
QRVREKESDEEKKSKKKDSMIAEEISSVNISLSEIFEHLLAYRQEATNRISSHIPLIIQY
FILQVFGQKLQKGMLQLLQDKDTYNWLLKERSDTSDKRKFLKERLARLTQARRRLAKFPG
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggttaaatctaaaggtaaaatcactgactcagatcctggatccaatcagctgttacta
aatggccttgctgatgaggaagagaaaaatcaggacacagagcccaagctcagcctgtgt
agccagtacgaggagaaggtgcgcccctgcatcgacctcatcgactccctgcgggcgctg
ggcgtggagcaggacctggccctgcccgccatcgccgtcatcggggaccagagctcgggc
aagagctcggtgctggaggctctgtcgggggtcgccctccccagaggcaacgggattgtt
acgagatgccctctggtgctgaagcttaagaagctcctgaacgaggacgagtggaggggc
aaagtcagttaccaggacttcgagatggagatttcagacccttcggaggtggaagtggaa
atcaataaagcccaggatgccattgccggggaagggcaggggatcagtcatgagctaatc
accctggaggtcagctcccctcatgtcccggatctgaccctgattgacctccctggcatc
accagggtggctgtgggcaatcagccggccgacatcggacgccagagcaagcaactcatc
aggaagtacatctttaagcaggagaccatcaacttggtggtggtcccctgcaatgtggac
atcgccaccacagaggcgctgagcatggctcaggaggtggaccccgatggagacaggacc
atagggatcttgacgaagcctgacctggtggacagaggtactgagagcaaggtggtggac
gtggcccagaacttggtctgtcacctgaagaagggctacatgatcgtcaagtgccggggc
cagcaggacatccaggaccaggtgaccctggccgaggctctgcagaaagagagagtcttc
tttgaggaccacccacatttcagggttctcctggaggaaggaagggccacagtcccctgc
ctggcggacaagctgacctctgaactcatctcgcacatctgtaaaactctgcccctgtta
gaaaatcagataaaggaaaaccatgagaagataacggaggagttacaaaagtacggctca
gatgtgcctgaagacgagcacgaaaaaatgttttttctgatagacaaaattaatgccttt
aaccatgacatcaactccttaatcgaaggggaagaatctgtgggagaggatgagagtcgg
ctgtttaccaaaatccgaaccgagttccacaaatggagcgctgtgattgagaagaggttc
caaaaaggttacaaagctatatataaacaaatcgagaaatttgaaaatcggtatcgcggc
agagagctgccagggtttgtcaattacaagacgttcgagattatcataaaacagcaaatc
aaagagctagaagagcccgctgtcgacatgctgcacacggttactgatatggtccaggct
gccttcacagatatttcaaaagcaaattttgatgaatttttcaacctctacagaactacc
aagtccaaaattgaagacattaaatttgagctagaaaaagaagctgagaagtccatccgc
cttcacttccaaatggagcagatcgtctactgccaggaccaggtgtaccagcgcgcgctg
caaagggtccgggagaaggagtcggacgaggagaagaagagcaagaaaaaagacagcatg
atcgccgaagaaatttcttcagtaaacatctccttgtctgaaatcttcgagcatttgctg
gcttaccgtcaggaggccaccaaccgcatctccagccacatccccctaatcatccagtac
ttcatcctgcaagtgttcggccagaagctgcagaagggcatgctgcagctgctgcaggac
aaggacacctacaactggctcctcaaggaacgcagcgacaccagcgacaagaggaagttc
ctgaaggagcggctggcgcggctgacccaggcccggcgccgcctggccaagttccccggt
taa

KEGG   Ursus arctos horribilis: 113256765
Entry
113256765         CDS       T05909                                 

Gene name
MX2
Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
uah  Ursus arctos horribilis
Pathway
uah05160  Hepatitis C
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113256765 (MX2)
   05164 Influenza A
    113256765 (MX2)
   05160 Hepatitis C
    113256765 (MX2)
   05165 Human papillomavirus infection
    113256765 (MX2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_15 AAA_21 AAA_29 AAA_16 Phasin_2 ABC_tran
Other DBs
NCBI-GeneID: 113256765
NCBI-ProteinID: XP_026356450
UniProt: A0A3Q7VVC9
LinkDB
Position
Unknown
AA seq 712 aa
MSKPQGSWPYQKRKMFLPQQQPKKELNFFQQQPPPSGEGAGHMMYPPNHQVRGLDTVSLT
KEFFSLALNPQQPEGSRGQQRAKGLELSLASQYEEKVRPCLDLIDSLRALGVEQDLALPA
IAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKRQRHECAWRGRLSYRKTDLP
LQDPSQVEKEILKAQNTIAGNGLSISHELISLEITSPEVPDLTLIDLPGITRVPVGNQPQ
DIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLV
DKGTEPVVVRVAQNLTYRLQKGFMIVRCRGQEEVTNKMTLAEATMKETTFFQTHPHFRAL
LEEGKATVPCLAERLTNELILHINKSLPLLEKQIRESHQRATEELRQCGEDIPSDEADRL
FFLIEKIKVFNQDIGKLIEGEEVVKEKETRLYNKIRQEFEKWVLVLTANTQKVKNIIHKE
VSIYEKQYRGKELLGFVNYKTFETIVHQYLEQLVDPALAVLLKAVEIVWETFANTAKKHF
SEFSNLNQTAQNKIEGIKTKQAETAENLIRLQFRMEQLVYCQDEIYREVLNQVRKEFFNP
VGTSLKDPELKLSFSKDQSSMSSITEIGTHLNAYFWETSKRLANQIPFIIQYFVLQENGS
CLQKAMMQILQDREHYSWLLQEQSDTSTKRRFLKEKIYRLTQARHALYNFCN
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgtcgaagccacaagggtcttggccataccagaagcggaaaatgtttcttcctcaacag
caaccaaaaaaagaactgaatttcttccagcaacagccaccgccatctggtgagggagca
ggacacatgatgtatcccccaaaccatcaggtcagagggctggataccgtttccctcacc
aaggagttcttctcgctggcactgaaccctcagcagccagaaggaagcaggggccaacag
agggcaaagggcctcgagctcagcctggctagccagtacgaggagaaggtgcgcccctgc
ctcgacctcatcgactccctgcgggcgctgggcgtggagcaggacctggccctgcccgcc
atcgccgtcattggggaccagagctcgggcaagagctcggtgctggaggctctgtcaggc
gtcgccctccccagaggcagcggaatcgtgaccaggtgcccgctggtgttgaagctgaag
aggcagcggcacgagtgcgcgtggagggggcggctcagctaccgcaagacggacctcccg
ctccaggacccctcccaggtggagaaggagatcctcaaagcccagaacaccatagctggg
aacggacttagcatcagccatgagctcatcagtctggagatcacctcccctgaggtcccg
gatctgaccctcattgacctccccggcatcaccagggtgcctgtgggaaaccagccccag
gacatcggattgcagatcaaggcactcatcaagaagtacattcagaggcagcagaccatc
aacttggtggtggtcccctgcaacgtggacatcgccaccacggaggcactgagcatggct
caggaagtggaccccgaaggagacagaaccataggagtcctgaccaaaccagatctcgtg
gacaagggcaccgaacccgtggtcgtgagagtggcgcagaacctcacgtaccgtctccag
aagggcttcatgatcgtgaggtgccggggccaggaggaggtcaccaacaagatgaccctg
gccgaggcgaccatgaaagaaacgacgttcttccagacacatccgcatttcagagctctc
ctggaggaaggaaaggccacggtgccctgtctggcagaaagactgaccaacgagctcatc
ttgcacattaataaatcactcccgttgttagaaaagcagataagggagagccaccagagg
gcgacggaggagctgcgccagtgtggagaggacatacccagcgatgaagccgatagactg
ttcttcctgatcgagaaaattaaggtgtttaatcaggacattggaaagttaatagaagga
gaagaagtcgtaaaggagaaagagacccgcctatataacaaaatcaggcaggagtttgaa
aaatgggtactcgtactcacagccaatacccaaaaagttaaaaatattattcacaaagaa
gtctcaatatatgaaaagcagtatcgtggcaaagagctgcttggatttgtcaactacaag
acgttcgagaccatcgtgcaccagtacctggaacagctggtagaccccgcgctcgctgtg
ctcctgaaggctgttgaaattgtctgggaaacgttcgccaacacagccaagaaacatttt
agtgaattttccaaccttaatcaaacagcccagaacaagatcgaaggcataaaaacgaaa
caagcagaaacagcagaaaatctgatccgacttcagttcagaatggagcagctcgtttac
tgtcaagatgagatttacagagaggttctgaaccaagtccggaaagagttttttaacccc
gtggggacgtccttgaaggatcctgagttaaaactgtctttctccaaagatcagtcttcg
atgtcgtccatcactgagattgggacgcacctgaatgcctacttctgggaaaccagcaag
cgtctcgccaaccagatcccattcataattcagtatttcgtactccaagagaacggcagt
tgcttgcagaaagccatgatgcagatattacaggacagagagcactactcctggctgctt
caagaacagagtgacacctccaccaagaggcgattcctcaaggagaagatttaccggctg
actcaggctcggcacgctctctataacttctgcaattaa

DBGET integrated database retrieval system