KEGG   Ursus arctos horribilis: 113256785
Entry
113256785         CDS       T05909                                 

Definition
(RefSeq) C-C chemokine receptor type 1-like isoform X1
  KO
K04176  C-C chemokine receptor type 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256785
   04061 Viral protein interaction with cytokine and cytokine receptor
    113256785
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113256785
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113256785
   05167 Kaposi sarcoma-associated herpesvirus infection
    113256785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113256785
   04050 Cytokine receptors [BR:uah04050]
    113256785
   04090 CD molecules [BR:uah04090]
    113256785
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113256785
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113256785
CD molecules [BR:uah04090]
 Proteins
  113256785
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw DUF1240
Other DBs
NCBI-GeneID: 113256785
NCBI-ProteinID: XP_026356438
UniProt: A0A3Q7WQE8
LinkDB
Position
Unknown
AA seq 355 aa
MQTSAPTNDYDVTTEYDYEGITPCQKGEVRAFGAQLLPPLYSLVFIIGVVGNILVLLVLM
QYKRLKSMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFSDGTCKLLSGLYYTGLYSE
IFFIILLTIDRYLAIVHAVFALQVRTVFFGIISSAGAWGLAILASIPGFYFSKIQREFSH
TTCSLHFPHGNLKGWKQFQALKLNMLGLVLPLLVMIISYTEIIRILLKRPNEKKAKAVRL
IFVIMIVFFLFWTPYNLAVLVSAFQDRLFTDECRQSKQLDLAMQVTEVIAYTHCCVNPVI
YAFVGERFRRYLRQLFRRLLSVRLVKGLPFLSTDRLERTSSMSPSTAEHELSAGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgcaaacctcagcccccacaaatgactatgatgtgacgacagaatatgactatgagggc
ataaccccgtgccagaagggagaggtgagggcctttggagcccagctgctgccccccttg
tactccctggtgttcatcattggcgtggtcggcaacatcctggtcctcctggtcctcatg
caatacaagaggctcaagagcatgaccagcatttacctcctgaacctggccatctcggac
ctgctcttcctcttcacgctgcccttctggatcgactacaagctcaaggatgactgggtt
ttcagtgacggcacctgtaagttgctctcggggctttattacacgggcttgtacagtgag
atcttttttatcatcctgctgaccatcgacaggtacctggccatcgtccatgccgtgttt
gccctgcaggtccggactgtcttcttcggtatcatctccagcgctggcgcctggggcctg
gccatcttggcctccatcccaggcttctacttttccaagatccagcgggagttctcccat
accacctgcagcctccacttccctcatgggaacctcaaaggctggaaacagttccaggct
ctgaaactgaacatgttggggctggttttgcctctgttggtcatgatcatctcctacaca
gagattatacggatcctgctcaaacgacccaacgagaagaaggccaaagccgtccgtctg
atcttcgtcatcatgatcgtcttctttctcttctggaccccctacaacctggccgtgttg
gtctctgctttccaagacagacttttcaccgatgagtgcaggcagagcaagcagctggac
ctggccatgcaggtgacggaggtgatcgcctacacacactgctgcgtcaaccccgtcatc
tacgccttcgtcggggagcggttccgcaggtacctacgccagctgttccgccggctactg
tctgtgcgcctggtgaaagggctccccttcctctccaccgacaggctcgagaggaccagc
tccatgtccccctccacggcggagcacgaactctccgctgggttctga

DBGET integrated database retrieval system