KEGG   Ursus arctos horribilis: 113256789
Entry
113256789         CDS       T05909                                 

Gene name
CCR2
Definition
(RefSeq) C-C chemokine receptor type 2
  KO
K04177  C-C chemokine receptor type 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256789 (CCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113256789 (CCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113256789 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113256789 (CCR2)
   04050 Cytokine receptors [BR:uah04050]
    113256789 (CCR2)
   04090 CD molecules [BR:uah04090]
    113256789 (CCR2)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113256789 (CCR2)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113256789 (CCR2)
CD molecules [BR:uah04090]
 Proteins
  113256789 (CCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 113256789
NCBI-ProteinID: XP_026356449
UniProt: A0A3Q7WQF7
LinkDB
Position
Unknown
AA seq 373 aa
MGDNGTFPQASHNVLSTSHSLFTTNIQGSDEEPTTIYDYDYSAPCQKTDVRLIAAGLLPP
LYSLVFIFGFVGNMLVVLILINCKRLKSMTDIYLLNLAVSDLLFLLTIPFWAHYAAHGWL
LGKVMCKSFTGLYHVGYFGGNFFIILLTIDRYLAIVHAVFALKARTVTFGVLTSGVTWVV
AVFAALPGIVFARVESDEDFLTCAPHFAKTWKSFHTIMRSVLGLVLPLLVMVICYSAILK
TLLRCRNEKKRHKAVKLIFVIMIVYFLFWAPNNIVLLLSTFQESFNVSNCQSTSQLDQIM
QVTETLGMTHCCVNPIIYAFVGEKFRRYLSMFFRKHIAKRLCKQCPVFYRETADRVSSTY
TPSTGEQEVSAGL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggtgacaatggcacgtttccccaggccagccacaacgtgctgtccacatcgcattct
ctgttcacaaccaatatccagggcagcgatgaagaacccaccaccatttatgactatgat
tacagcgcgccctgtcagaagaccgacgtgagactgatcgccgccgggctcctgcccccg
ctctactcgctggtgttcatcttcggcttcgtgggcaacatgctggttgtcctcatcctc
atcaactgcaagaggctgaagagcatgaccgacatctacctgctcaacctggccgtctcc
gacctgctcttcctcctcaccatcccattctgggcccactacgccgcgcacgggtggctc
ttggggaaggtgatgtgtaagtcattcaccgggctgtatcacgttgggtattttggcgga
aacttcttcatcatcctcctgaccatcgacaggtacctggcgatcgtccacgccgtgttt
gcattaaaggccaggacggtcacctttggggtgttgacaagcggggtcacctgggtggtg
gccgtgtttgccgctctccccgggatcgtcttcgcgagagtggaaagtgatgaagatttt
ctcacctgcgctcctcactttgcaaaaacatggaagagtttccatacaataatgaggagc
gtcttggggctggtcctgcccctgcttgtcatggtcatctgctactcggccatcctcaag
actctgctccggtgccgaaacgagaagaagaggcacaaggccgtgaagctcattttcgtg
atcatgatcgtgtactttctcttctgggctcccaacaacatcgtgcttctcctgagcacc
ttccaggagtcctttaacgtgagcaactgtcagagcaccagtcagctggaccaaatcatg
caggtgacagagacccttgggatgacgcactgctgcgtcaaccccatcatctacgccttc
gtcggggagaaattcagaaggtatctctccatgttcttccgaaagcacatcgctaaacgc
ctctgcaaacagtgcccagtcttctacagggagaccgcggatcgagtgagttccacctac
acgccttccacaggggagcaggaggtctcggctggcttgtaa

DBGET integrated database retrieval system