KEGG   Ursus arctos horribilis: 113256876
Entry
113256876         CDS       T05909                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
uah  Ursus arctos horribilis
Pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04150  mTOR signaling pathway
uah04270  Vascular smooth muscle contraction
uah04310  Wnt signaling pathway
uah04350  TGF-beta signaling pathway
uah04360  Axon guidance
uah04510  Focal adhesion
uah04520  Adherens junction
uah04530  Tight junction
uah04611  Platelet activation
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04660  T cell receptor signaling pathway
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04921  Oxytocin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04972  Pancreatic secretion
uah05100  Bacterial invasion of epithelial cells
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113256876 (RHOA)
   04015 Rap1 signaling pathway
    113256876 (RHOA)
   04310 Wnt signaling pathway
    113256876 (RHOA)
   04350 TGF-beta signaling pathway
    113256876 (RHOA)
   04072 Phospholipase D signaling pathway
    113256876 (RHOA)
   04071 Sphingolipid signaling pathway
    113256876 (RHOA)
   04024 cAMP signaling pathway
    113256876 (RHOA)
   04022 cGMP-PKG signaling pathway
    113256876 (RHOA)
   04150 mTOR signaling pathway
    113256876 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113256876 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113256876 (RHOA)
   04520 Adherens junction
    113256876 (RHOA)
   04530 Tight junction
    113256876 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113256876 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113256876 (RHOA)
   04621 NOD-like receptor signaling pathway
    113256876 (RHOA)
   04625 C-type lectin receptor signaling pathway
    113256876 (RHOA)
   04660 T cell receptor signaling pathway
    113256876 (RHOA)
   04670 Leukocyte transendothelial migration
    113256876 (RHOA)
   04062 Chemokine signaling pathway
    113256876 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    113256876 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    113256876 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113256876 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    113256876 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113256876 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    113256876 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256876 (RHOA)
   05206 MicroRNAs in cancer
    113256876 (RHOA)
   05205 Proteoglycans in cancer
    113256876 (RHOA)
   05203 Viral carcinogenesis
    113256876 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113256876 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113256876 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113256876 (RHOA)
   05135 Yersinia infection
    113256876 (RHOA)
   05133 Pertussis
    113256876 (RHOA)
   05152 Tuberculosis
    113256876 (RHOA)
   05100 Bacterial invasion of epithelial cells
    113256876 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113256876 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113256876 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113256876 (RHOA)
   04031 GTP-binding proteins [BR:uah04031]
    113256876 (RHOA)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    113256876 (RHOA)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113256876 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   113256876 (RHOA)
  Exosomal proteins of colorectal cancer cells
   113256876 (RHOA)
  Exosomal proteins of bladder cancer cells
   113256876 (RHOA)
GTP-binding proteins [BR:uah04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    113256876 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 113256876
NCBI-ProteinID: XP_026356624
UniProt: A0A3Q7WR12
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaggtatatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc
ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa
ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system