KEGG   Ursus arctos horribilis: 113256975
Entry
113256975         CDS       T05909                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04140  Autophagy - animal
uah04270  Vascular smooth muscle contraction
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04722  Neurotrophin signaling pathway
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113256975 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113256975 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    113256975 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    113256975 (PRKCD)
   04062 Chemokine signaling pathway
    113256975 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113256975 (PRKCD)
   04915 Estrogen signaling pathway
    113256975 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113256975 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113256975 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113256975 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113256975 (PRKCD)
   04931 Insulin resistance
    113256975 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113256975 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113256975 (PRKCD)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     113256975 (PRKCD)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   113256975 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 Kinase-like zf-RING-like Zf_RING Pkinase_fungal zf-RING_9 PHD DUF2318 DZR APH FYVE_2
Other DBs
NCBI-GeneID: 113256975
NCBI-ProteinID: XP_026356818
UniProt: A0A3Q7W695
LinkDB
Position
Unknown
AA seq 672 aa
MAPFLRIAFTSYELGSLQTADEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRGEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFRQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALNQVSQRPSR
KSETETVGIYQNFERKPGVSGDIVPDNGTYGKIWEGSTRCNIENFTFHKVLGKGSFGKVL
LAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLFCTFQTKDHLF
FVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHNKGIIYRDLKLDNVMLDQD
GHIKIADFGMCKENIFGEKQASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIG
QSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLLERDTAKRLGVNGNIKIHPFFK
TINWTLLEKRAVEPPFKPKVKSPGDYSNFDQEFLNEKARLSYTDKNLIDSMDQTAFAGFS
FVNPKFERFLEK
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcgccattcctgcgcattgccttcacctcctatgagctgggctccttgcagaccgcc
gatgaggccagccagcccttctgtgccgtgaagatgaaggaggcgctcagcacagagcgt
gggaagacgctggtgcagaagaagcccaccatgtaccccgagtggaagtccacattcgac
gcccacatctacgagggccgtgtcatccagatcgtgctgatgcgggccgccgaagagccg
atgtccgaggtgacggtgggcgtatcggtgctggctgaacgctgcaagaagaacaacggc
aaggccgagttctggctggacctgcaaccccaggccaaggtgttgatgtctgtgcagtat
ttcctggaagatgtagattgcaaacagtctatgcgtggtgaagacgaggccaagttccca
acaatgaaccgccgtggagccatcaaacaggccaaaattcactacatcaagaaccacgag
tttattgccaccttcttcagacagcccactttctgttctgtgtgcaaagacttcgtttgg
ggtctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccacaagaaatgc
atcgacaagatcatcggccggtgcacgggcaccgcggccaacagccgggacaccatattc
cagaaagaacgtttcaacattgacatgccgcatcgattcaaggtttacaactatatgagc
cccaccttctgtgaccactgcggcagcctgctctgggggctggtgaagcagggcttaaaa
tgtgaagactgtggcatgaacgtacatcataagtgccagaagaaggtggccaacctctgc
ggcattaaccagaagctcctggctgaggcgttgaaccaagtgagccagagaccctcccgg
aagtcagaaacagagactgttggaatctaccagaattttgagaggaagccaggagtctct
ggagatattgtcccagacaacggtacctacggcaagatctgggagggcagcaccaggtgc
aacattgagaacttcaccttccacaaggtcctgggcaaaggcagctttgggaaggtgctg
cttgcagagctgaagggcaagaaggagttcttcgccatcaaggccctcaagaaggacgtg
gttctgatcgatgacgatgtggagtgcaccatggtggagaagcgggtgctggcactcgcc
tgggagaatccctttctcacccacctcttctgcacattccagaccaaggaccacctgttc
ttcgtgatggagttcctcaacgggggggacctgatgtaccacatccaggacaaaggccgc
ttcgagctctaccgtgccacgttttatgcagccgagatagtctgtggactacagtttctg
cacaacaaagggatcatttacagggacctcaagctggacaacgtgatgctggaccaggat
ggccacatcaagattgctgactttgggatgtgcaaggagaacatatttggggagaaacag
gctagcaccttctgtggcacccctgactatatcgcccccgagatcctgcagggcctgaag
tactcattctccgtggactggtggtcctttggagtccttctctatgagatgctcatcggt
cagtcccccttccatggtgacgatgaggacgagctctttgagtccatccgtgtggataca
ccacattatccccgctggatcaccaaggagtccaaggacattctggagaagctgcttgaa
agggatacagccaagaggctgggagtgaacgggaacatcaaaatccaccccttcttcaag
accatcaactggactctgctggagaaacgggccgtggagccgcccttcaagcccaaagtg
aagtcccctggagactacagcaacttcgaccaggagttcctgaacgagaaggcacgcctc
tcctacactgacaagaacctcatcgactccatggaccaaacggcattcgctggcttctcc
ttcgtgaaccccaaatttgagagattcctggaaaagtga

DBGET integrated database retrieval system