KEGG   Ursus arctos horribilis: 113257190
Entry
113257190         CDS       T05909                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04218  Cellular senescence
uah04270  Vascular smooth muscle contraction
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04726  Serotonergic synapse
uah04730  Long-term depression
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04929  GnRH secretion
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05034  Alcoholism
uah05132  Salmonella infection
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113257190 (RAF1)
   04015 Rap1 signaling pathway
    113257190 (RAF1)
   04010 MAPK signaling pathway
    113257190 (RAF1)
   04012 ErbB signaling pathway
    113257190 (RAF1)
   04370 VEGF signaling pathway
    113257190 (RAF1)
   04371 Apelin signaling pathway
    113257190 (RAF1)
   04630 Jak-STAT signaling pathway
    113257190 (RAF1)
   04068 FoxO signaling pathway
    113257190 (RAF1)
   04072 Phospholipase D signaling pathway
    113257190 (RAF1)
   04071 Sphingolipid signaling pathway
    113257190 (RAF1)
   04024 cAMP signaling pathway
    113257190 (RAF1)
   04022 cGMP-PKG signaling pathway
    113257190 (RAF1)
   04151 PI3K-Akt signaling pathway
    113257190 (RAF1)
   04150 mTOR signaling pathway
    113257190 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113257190 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    113257190 (RAF1)
   04218 Cellular senescence
    113257190 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113257190 (RAF1)
   04540 Gap junction
    113257190 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113257190 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113257190 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113257190 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    113257190 (RAF1)
   04660 T cell receptor signaling pathway
    113257190 (RAF1)
   04662 B cell receptor signaling pathway
    113257190 (RAF1)
   04664 Fc epsilon RI signaling pathway
    113257190 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    113257190 (RAF1)
   04062 Chemokine signaling pathway
    113257190 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113257190 (RAF1)
   04929 GnRH secretion
    113257190 (RAF1)
   04912 GnRH signaling pathway
    113257190 (RAF1)
   04915 Estrogen signaling pathway
    113257190 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    113257190 (RAF1)
   04917 Prolactin signaling pathway
    113257190 (RAF1)
   04921 Oxytocin signaling pathway
    113257190 (RAF1)
   04926 Relaxin signaling pathway
    113257190 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    113257190 (RAF1)
   04919 Thyroid hormone signaling pathway
    113257190 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    113257190 (RAF1)
   04916 Melanogenesis
    113257190 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113257190 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    113257190 (RAF1)
   04720 Long-term potentiation
    113257190 (RAF1)
   04730 Long-term depression
    113257190 (RAF1)
   04722 Neurotrophin signaling pathway
    113257190 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    113257190 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257190 (RAF1)
   05206 MicroRNAs in cancer
    113257190 (RAF1)
   05205 Proteoglycans in cancer
    113257190 (RAF1)
   05230 Central carbon metabolism in cancer
    113257190 (RAF1)
   05231 Choline metabolism in cancer
    113257190 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113257190 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113257190 (RAF1)
   05212 Pancreatic cancer
    113257190 (RAF1)
   05225 Hepatocellular carcinoma
    113257190 (RAF1)
   05226 Gastric cancer
    113257190 (RAF1)
   05214 Glioma
    113257190 (RAF1)
   05221 Acute myeloid leukemia
    113257190 (RAF1)
   05220 Chronic myeloid leukemia
    113257190 (RAF1)
   05218 Melanoma
    113257190 (RAF1)
   05211 Renal cell carcinoma
    113257190 (RAF1)
   05219 Bladder cancer
    113257190 (RAF1)
   05215 Prostate cancer
    113257190 (RAF1)
   05213 Endometrial cancer
    113257190 (RAF1)
   05224 Breast cancer
    113257190 (RAF1)
   05223 Non-small cell lung cancer
    113257190 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113257190 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    113257190 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113257190 (RAF1)
   05152 Tuberculosis
    113257190 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113257190 (RAF1)
   05164 Influenza A
    113257190 (RAF1)
   05161 Hepatitis B
    113257190 (RAF1)
   05160 Hepatitis C
    113257190 (RAF1)
   05163 Human cytomegalovirus infection
    113257190 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113257190 (RAF1)
   05165 Human papillomavirus infection
    113257190 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113257190 (RAF1)
   01522 Endocrine resistance
    113257190 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113257190 (RAF1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113257190 (RAF1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   113257190 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 113257190
NCBI-ProteinID: XP_026357185
UniProt: A0A3Q7VX19
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaacggttttggattcaaagacaca
gtgtttgacggccccagctgcatctcccctacaatagttcagccctttggctttcagcgt
cgggcatcagatgatggcaaacttacggactcgtctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcacgat
tgccttatgaaagcactcaaggtgaggggcctacagccggaatgctgtgctgtgttcaga
ctgctccatgaacataaaggtaaaaaagcacgtttagattggaatactgatgccgcctcg
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaactcacaac
tttgcacggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatggatttcgttgtcagacttgcggctacaaatttcacgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttattgtttccaaattctact
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcgaatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacattc
aactcctccagcccttcctccgaaggttccctctcccagaggcagagatcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaacaggctggtcgcagcccaaaactcctgttccagcacagagagagcgggcacca
ggatctgggacccaggagaaaaacaaaatcaggcctcgtggacaaagagattcaagctat
tactgggaaatagaagccagcgaagtgatgctgtccactcggattgggtcaggctccttt
ggaacagtgtataagggcaagtggcacggagatgttgcagtaaagatcctaaaggttgtc
gaccccaccccagagcagttccaggccttcaggaacgaggtggctgtcctccgcaaaaca
cggcacgtgaatatcctgctcttcatggggtacatgacaaaggacaacctggcgatcgtg
acccagtggtgtgaaggcagcagcctctacaaacacctgcatgtccaggaaactaaattc
cagatgttccagctgatcgacatcgcccgtcagactgctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaatcggagattttggtttggcaacagtaaagtcacgctggagcggttctcag
caggttgaacaacccactggctccgtcctgtggatggcccccgaggtgatccgaatgcag
gataacaacccgttcagcttccagtcggatgtctactcctacggcattgtgctctacgag
ctcatgacaggggagcttccttactcccacatcaataaccgcgatcagatcatcttcatg
gtgggccgagggtacgcctccccagacctcagtaagctgtataagaactgccccaaagca
atgaagaggctcgtagccgactgtgtgaagaaggttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctgccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaacgcctgcacattgacc
acgtcccctagactgcctgtcttctag

DBGET integrated database retrieval system