KEGG   Ursus arctos horribilis: 113257571
Entry
113257571         CDS       T05909                                 

Gene name
EIF4B
Definition
(RefSeq) eukaryotic translation initiation factor 4B isoform X1
  KO
K03258  translation initiation factor 4B
Organism
uah  Ursus arctos horribilis
Pathway
uah03013  RNA transport
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113257571 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113257571 (EIF4B)
   04150 mTOR signaling pathway
    113257571 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113257571 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113257571 (EIF4B)
   03012 Translation factors [BR:uah03012]
    113257571 (EIF4B)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     113257571 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     113257571 (EIF4B)
Translation factors [BR:uah03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    113257571 (EIF4B)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 113257571
NCBI-ProteinID: XP_026357570
UniProt: A0A3Q7VXW3
LinkDB
Position
Unknown
AA seq 617 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRLGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSATSGRSKSDQDARRRESEKSLENEAPSKEEDCHSPTSKPPKSEQPLKVMP
APPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVLPAQPPEEGPARRADENKVDGVS
VPKGQSGNSSRGPGDGGNKDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYA
ALSVDGEDENEGEDYTE
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaaaactatctccctaacagacttt
ctggctgaggatggagggactgggggaggaagcacctatgtccccaaaccagtcagctgg
gctgatgaaacagatgacctggaaggagatgtttcaaccacttggcacagtaatgatgac
gacgtgtatagggcacctccaattgaccgttccatcctgcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttccaaaatcgccaccctatactgcttttcta
gggaacctgccctatgatgtgacagaagaatccattaaggaattctttagaggattaaat
atcagtgcggtgcgcttaccacgtgaacccagcaatccagagaggttgaaaggctttggt
tacgctgagtttgaggacctggattctttgctcagtgccctgagcctcaacgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaggataaagacagggat
gatcgttcttttggccgagatagaaatcgggattctgacaaaacagatacagactggagg
gcacgtcctgccacagacagctttgatgactacccgccgaggagaggtgatgacagcttt
ggagacaagtatcgagatcgttacgattcagaccgctaccgtgatgggtatcgggacggg
tatcgtgatggcccacgccgagacatggatcgatatgggggccgggatcgctatgatgac
cgaggcagcagagactacgacagaggctacgattccaggctaggcagtggcagaagagca
tttggtagtgggtaccgcagggatgacgactacagaggaggcggggaccgctacgaagac
agatacgacagacgagacgaccggtcatggagctccagggatgattactctcgggatgac
tatcggcgtgatgatagaggtcccccccaaagacccaaactgaatctaaagcctcggagt
actcctaaggaagatgattcctctgccagcacctcccagtccagtcgagcggcctccatc
tttggaggggcaaagcctgtcgacacggcggctagagagcgagaagtagaagagcggctg
cagaaggagcaggagaagctgcagcgccagctggacgagccgaaactagaacgacggccc
cgggagagacacccaagctggcgaagtgaagagactcaggaacgggaacggtccaggaca
ggaagtgagtcatcacagactgggacctcggccacatctggcagaagtaagtcagaccag
gatgcacgaaggagagagagtgagaagtctctcgaaaatgaagcacccagtaaggaggaa
gactgtcactctccaacttctaagcctcccaaatctgaacagccgctgaaggtaatgccg
gcccctccaccaaaggagaatgcttgggtgaagcgaagttctaaccctcctgctcgatct
cagagctcagacacagagcagcagtcccctacaagtggtgggggaaaagtacttccagct
cagccacccgaggaaggaccagcaaggagagcagatgaaaacaaagtagatggggtgagt
gtcccaaaaggccaaagtgggaactccagccgtggtccaggagacggagggaacaaagac
cactggaaggagtcagataggaaagatggcaaaaaggatcaagactcccgatctgcacct
gagccaaagaaacctgaagaaaatccagcttccaagttcagttctgcaagcaagtacgct
gctctctctgttgatggcgaagatgagaacgagggagaagattacactgaatag

DBGET integrated database retrieval system