KEGG   Ursus arctos horribilis: 113257870
Entry
113257870         CDS       T05909                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04012  ErbB signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04151  PI3K-Akt signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04934  Cushing syndrome
uah05162  Measles
uah05165  Human papillomavirus infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05206  MicroRNAs in cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05222  Small cell lung cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113257870 (CDKN1B)
   04066 HIF-1 signaling pathway
    113257870 (CDKN1B)
   04068 FoxO signaling pathway
    113257870 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    113257870 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113257870 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257870 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    113257870 (CDKN1B)
   05206 MicroRNAs in cancer
    113257870 (CDKN1B)
   05203 Viral carcinogenesis
    113257870 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    113257870 (CDKN1B)
   05220 Chronic myeloid leukemia
    113257870 (CDKN1B)
   05215 Prostate cancer
    113257870 (CDKN1B)
   05222 Small cell lung cancer
    113257870 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113257870 (CDKN1B)
   04934 Cushing syndrome
    113257870 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    113257870 (CDKN1B)
   05169 Epstein-Barr virus infection
    113257870 (CDKN1B)
   05165 Human papillomavirus infection
    113257870 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113257870 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113257870
NCBI-ProteinID: XP_026358180
UniProt: A0A3Q7VZI0
LinkDB
Position
Unknown
AA seq 200 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGVCKVPAQESQDVSGNRQAVPLIG
SQANSEDTHLVDQKTDTPDNQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
ANAGSVEQTPKKPGLRRRQT
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctagagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgtctgcaag
gtgccggcgcaggagagccaggacgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacacatttggtagaccaaaagactgatacgccggacaac
cagaccgggttagcggagcagtgcactgggataaggaagcgacctgccacggacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gcgaacgcgggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacg
taa

DBGET integrated database retrieval system