KEGG   Ursus arctos horribilis: 113257985
Entry
113257985         CDS       T05909                                 

Gene name
LTBR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 3 isoform X1
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04064  NF-kappa B signaling pathway
uah04066  HIF-1 signaling pathway
uah04672  Intestinal immune network for IgA production
uah05166  Human T-cell leukemia virus 1 infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113257985 (LTBR)
   04066 HIF-1 signaling pathway
    113257985 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113257985 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113257985 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113257985 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113257985 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113257985 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113257985 (LTBR)
Cytokine receptors [BR:uah04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113257985 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 113257985
NCBI-ProteinID: XP_026358405
UniProt: A0A3Q7W068
LinkDB
Position
Unknown
AA seq 428 aa
MRLPWAASPCGLAWGPLILGLCGLLAASQAQLVREGPVQEPPYHTENQTCRDWEKEYYEP
KDQVCCSRCPPGTHVSEECSRSQDTICAVCPENSYNEHWNHLSICQLCRPCDQMLGFEET
VPCTSTQKTQCRCQPGMFCVHWDTECIHCEPLSDCPPGTEAELTDEVGVANRNCVPCKAG
HFQNTSSPRARCQPHTRCEERGLVEAVPGTAQSDSSCRNPPQHPEMPGTVMVLAILLPLA
SFLFLTTVLACTWKSHPSLCRKLGSLLKRRPEGEESNTADGSWEPPRVNPHFPDLVKPLL
PLSGDVAPSSARPQAPLNLEEEVLQQQSPFSQARELEPELPEQSQVAHGTNGIHVTGGSV
TVTGNIYIYNGPVLGGARGPGDPPASPEPPYPTPEEGAPGPPGLSTPYQEDGKAWHLAET
ETLGCHAL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcgcctgccatgggctgcctccccctgcggcctggcctgggggccactcatcctgggc
ctctgcggtctcctggcagcatcccaggcccaactggtgagggaggggcccgtgcaggag
cccccataccacacggagaaccaaacctgccgggactgggaaaaggagtactacgaaccc
aaggatcaggtctgctgctcccgctgccccccaggcacacacgtctccgaggaatgcagc
cgcagccaggacaccatttgtgccgtgtgtcccgaaaattcctacaacgagcactggaac
catctctccatctgccagctgtgccgcccctgtgaccagatgctgggcttcgaggagacc
gtgccttgcaccagcacgcagaagacccagtgccgctgccagccgggaatgttctgcgtg
cactgggacacagagtgtatacactgcgagccactctccgactgcccgccgggcaccgaa
gccgagctgacagatgaagtcggagtggcgaacagaaactgtgtgccctgtaaggcaggc
cactttcagaacacctcctcccccagggcccgctgccagccccacacaaggtgtgaggag
cggggcctggtggaggcggttccaggcactgcccagtctgacagcagctgcagaaatcca
ccgcagcaccctgagatgccaggaactgtgatggtgctggccatcctgctgccgctggcc
tcgttcctcttcctcaccaccgtcctggcctgcacctggaagagccacccctctctctgc
aggaagctgggatccctgctcaagaggcgtccagagggagaggaatcaaatactgctgat
ggaagctgggagcctccaagggtcaacccccatttccctgacctggtaaagccacttctg
cccctctccggagatgtggccccatcctcggccaggccccaagcacccctgaatttggag
gaagaggtgctacagcagcagagtccattcagccaggccagggagctggagcctgagctc
ccagagcaaagccaggtggcccatgggaccaacggcattcatgtcaccggcgggtctgtg
actgtcaccggcaacatctacatctacaatgggccagtactggggggagcacggggcccc
ggagacccccctgcttccccggagcctccgtaccccacccctgaagagggtgcccctggc
cctcccgggctctctacaccctaccaggaggatggcaaggcttggcacctggctgaaaca
gagacactgggctgccatgccctctaa

DBGET integrated database retrieval system