KEGG   Ursus arctos horribilis: 113258052
Entry
113258052         CDS       T05909                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04260  Cardiac muscle contraction
uah04261  Adrenergic signaling in cardiomyocytes
uah04270  Vascular smooth muscle contraction
uah04713  Circadian entrainment
uah04720  Long-term potentiation
uah04723  Retrograde endocannabinoid signaling
uah04724  Glutamatergic synapse
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04727  GABAergic synapse
uah04728  Dopaminergic synapse
uah04742  Taste transduction
uah04911  Insulin secretion
uah04912  GnRH signaling pathway
uah04921  Oxytocin signaling pathway
uah04924  Renin secretion
uah04925  Aldosterone synthesis and secretion
uah04927  Cortisol synthesis and secretion
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05020  Prion disease
uah05022  Pathways of neurodegeneration - multiple diseases
uah05031  Amphetamine addiction
uah05410  Hypertrophic cardiomyopathy
uah05412  Arrhythmogenic right ventricular cardiomyopathy
uah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113258052 (CACNA1C)
   04020 Calcium signaling pathway
    113258052 (CACNA1C)
   04024 cAMP signaling pathway
    113258052 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    113258052 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    113258052 (CACNA1C)
   04929 GnRH secretion
    113258052 (CACNA1C)
   04912 GnRH signaling pathway
    113258052 (CACNA1C)
   04921 Oxytocin signaling pathway
    113258052 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    113258052 (CACNA1C)
   04924 Renin secretion
    113258052 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    113258052 (CACNA1C)
   04927 Cortisol synthesis and secretion
    113258052 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113258052 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    113258052 (CACNA1C)
   04270 Vascular smooth muscle contraction
    113258052 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    113258052 (CACNA1C)
   04727 GABAergic synapse
    113258052 (CACNA1C)
   04725 Cholinergic synapse
    113258052 (CACNA1C)
   04728 Dopaminergic synapse
    113258052 (CACNA1C)
   04726 Serotonergic synapse
    113258052 (CACNA1C)
   04720 Long-term potentiation
    113258052 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    113258052 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    113258052 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113258052 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113258052 (CACNA1C)
   05020 Prion disease
    113258052 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    113258052 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    113258052 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    113258052 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    113258052 (CACNA1C)
   05414 Dilated cardiomyopathy
    113258052 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113258052 (CACNA1C)
   04934 Cushing syndrome
    113258052 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:uah04040]
    113258052 (CACNA1C)
Ion channels [BR:uah04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113258052 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 113258052
NCBI-ProteinID: XP_026358536
UniProt: A0A3Q7VBP7
LinkDB
Position
Unknown
AA seq 2168 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKCPYPNP
ENTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQ
AGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVTYYQS
DGRSAFPQTFTTQRPLHINKAANSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANN
TALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQIAMVCQEEVS
QDETYDVKMSEDTEYCSEPSLISTEMLSYQDDENRQLTPPEEDKRDVRQSPKRGFLRSAS
LGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPSTFPRPC
ATPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIHCSSWSGEPTPCGAGSSAIRRA
RPVSLTVPSQAGARGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTI
EEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAGGQEGETCAAALACRKSEEELQD
SRAHAGGL
NT seq 6507 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccagaggaaaatcatcaaggttctaactat
gggagcccgcgcccagctcatgccaacatgaatgccaatgccgctgcggggctcgcccct
gagcacatccctacgccgggggcagccctgtcctggcaggcggctatcgacgcggcccgg
caggccaagctgatgggcagcgccggcaacgcgaccatctccacggtcagctccacgcag
cggaagcggcagcagtatgggaaacccaagaagcagggcagcacgactgccacgcgcccg
ccccgcgccctgctctgcctgactctgaagaaccccatccggagggcatgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagacgactccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttactgtggaagcatttttaaaagtaatagcc
tatggacttctctttcatcccaacgcttacctccgcaatggttggaatttactagatttt
ataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagctgacggg
gcaaatgctctgggagggaaaggagctggatttgacgtgaaggcactgagggcattccgc
gtgctgcgccccttgcgcctggtatctggagtcccaagtctccaggtggttctgaattcc
attatcaaggccatggtgcccctgctgcatattgctctgttagtgctgtttgtaatcatc
atctatgccatcattggcctggagctcttcatggggaagatgcataagacctgctacaac
caggagggcatagcagatgttccagcagaagatgatccttccccttgtgctctggagaca
ggccatgggcgtcagtgtcagaacggcactgtgtgcaagcctgggtgggacgggcccaag
cacggcatcaccaacttcgacaattttgccttcgccatgttgacagtgttccagtgcatc
accatggagggctggacagacgtcctgtactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttctccaaagagagggagaaggccaaggctcggggagat
ttccagaaacttcgagagaagcagcagctggaagaggatctgaagggctacctggactgg
atcacccaggcagaggacattgaccctgagaatgaggatgaaggcatggatgaggagaag
ccccgaaacatgagtatgcccacaagcgagaccgagtctgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagagaactgcggggccaggctggcccaccggatttccaaatca
aagttcagccgctactggcgccgctggaatcggttctgcagaagaaagtgtcgtgccgca
gtcaagtctaatgtcttctactggcttgtgatcttcctggtgttcctcaacactctcacc
attgcctcggaacactacaaccagccccactggctcacggaggtgcaagacacggccaac
aaggcgctgctggcccttttcactgcagagatgctgctgaagatgtacagcctgggcctg
caggcctacttcgtgtccctcttcaaccgcttcgactgtttcatcgtgtgtggtggcatc
ctggagaccatcctggtggagaccaagatcatgtctcccttgggcatctctgtgttgaga
tgtgtccggctactgcggatatttaaaatcacaaggtactggaactccttaagcaacctg
gtggcatccttgctgaattctgtgcgctccattgcctccctactgctgctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gaaatgcagacccggaggagcacatttgataactttccccagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaagaagaagagaaggagagaaagaagctggccagg
actgccagcccagagaagaaacaagaggtggtggagaagccagcagtagaggagaccaag
gaggagaaaattgaactgaaatccattacagctgatggagagtccccacccaccaccaag
atcaacatggatgacctccagcccaatgaaaatgaggataagtgcccctacccaaaccca
gaaaatacaggagaagaggatgaggaggagcctgagatgcctgtgggcccccgcccacga
ccactctctgagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcgttt
ttcatcttcagccccaacaacagatttcgcctccagtgtcaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgcttagcagcatttccctggcagctgag
gaccccgtccagcacacctccttcaggaaccatattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatgactgcttatggggctttcctacac
aagggctctttttgccgaaactacttcaacatcttggacctgctggtggtcagcgtgtcc
ctcatttcctttggcatccagtcaagtgcaatcaacgtggtgaagatcttacgagtcctg
cgagtcctcagacccctaagggccatcaacagggccaaggggctgaagcacgtggttcag
tgcgtgttcgtcgccatccggaccatcgggaacatcgtcattgtcaccacgctactccag
ttcatgttcgcctgcatcggggtccagcttttcaagggaaagctctacacctgctcagat
agttccaaacagactgaggcggaatgcaagggtaactacatcacatacaaggacggggag
gtcgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaat
gttctggcagccatgatggccctctttaccgtctctacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatctttttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaagagcagggggagcaggaatacaagaactgt
gagctggacaagaaccagcgacagtgcgtggaatatgccctcaaggcccggcccctacgg
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
tttgaatacctgatgttcgtcctcatcctgctcaacaccatctgcttggccatgcagcac
tatggccagagctgcctcttcaaaattgccatgaacatcctcaacatgctcttcactggc
ctcttcaccgtggagatgattctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctc
agtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgcctggtcaagctgctgagccgcggagagggcatccggaccctgctgtggacc
ttcatcaaatccttccaggccctgccctatgtggcccttctgatagtgatgctgttcttc
atctatgcggtgattgggatgcaggtgtttgggaaaattgccctgaatgacaccacagag
atcaaccggaacaacaacttccagaccttcccccaagctgtgctgcttctcttcaggtgt
gccaccggggaggcatggcaggacatcatgctggcctgcatgccagggaagaagtgtgcc
cccgaatcggagcccagcaacagcacagaaggcgaaacaccctgtggcagcagcttcgcg
gtcttctacttcatcagcttctacatgctttgtgccttcctgatcatcaacctctttgta
gctgtcatcatggacaactttgactacctgacaagggactggtcaattcttggtccccat
catctggatgaatttaaaagaatctgggcagagtatgatcctgaagccaagggtcgtatc
aagcacctagatgtggtgaccctgcttcgacggatccagcccccactgggttttgggaag
ctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagt
gatgggacagtcatgttcaatgccaccctgtttgccctggtccggacagccctgcgaatc
aaaacagaagggaacctagaacaagccaatgaggagctgcgggccataatcaagaagata
tggaagcggaccagcatgaagctgttggaccaagtggtgcccccagcaggtgatgacgag
gtcacagttggcaagttttatgctactttcctgatccaagagtatttccggaaattcaag
aagcgcaaagagcagggcctagtgggcaagccctcccagaggaacgccctgtccctacag
gccggcttgcgcacgctgcatgacatcgggcctgagatccgacgggccatctctggggat
ctgacggctgaagaggagctggacaaggccatgaaggaggctgtgtctgctgcctccgaa
gacgacatcttcaggagggccggtggcctgttcggcaaccacgtcacctactaccaaagc
gacggccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaacaag
gcggctaacagccaaggcgacaccgagtcgccatcccacgagaaactggtggactccact
ttcacccccagcagctactcgtccactggctccaacgccaacatcaacaatgccaacaac
actgccctgggccgcttcccccgccccgctggttaccccagcgcggtcagcaccgtggag
ggccatgggccccccttgtctcctgccgtccgggtacaggaggcagcatggaagctcagc
tccaagaggtgccactcccgggagagccagatagccatggtgtgtcaggaggaggtctct
caggacgagacctatgacgtgaagatgagcgaagacaccgagtactgcagcgagcccagc
ctgatctccacagagatgctctcctaccaggatgatgaaaatcggcaattaacaccacct
gaggaggacaagagagacgtccggcaatctccaaagaggggtttcctccgctctgcctca
ctaggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaaggggga
gacatctctcagaagacagtcctgcccttgcatctggttcaccatcaggcattggcagtg
gcgggcctgagccccctcctccagagaagccattcccccagcacgttccccaggccatgt
gccacccccccagccacgccgggcagccgaggctggcccccacagccgatccccaccctg
cggctggagggggccgagtccagcgagaaactcaacagcagcttcccgtccatccactgc
agctcttggtccggggagcccacgccctgcggtgcgggcagcagcgccatccggagagcc
cggccggtgtccctcactgtgcccagccaggctggggcccggggcaggcagttccacggc
agcgccagcagcctggtggaagcggtcttgatttcagaaggactggggcagtttgctcaa
gatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatgaccata
gaagagatggagaacgccgccgacaacatcctcagtgggggcgcccagcagagccccaac
ggcaccctactaccttttgttaactgcagggacccagggcaggacagagcggggggccaa
gagggcgagacctgcgccgcggctctggcgtgtcggaaaagcgaggaggagctccaggac
agcagagcccacgccggcggcctgtag

DBGET integrated database retrieval system