KEGG   Ursus arctos horribilis: 113258461
Entry
113258461         CDS       T05909                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01524  Platinum drug resistance
uah04014  Ras signaling pathway
uah04064  NF-kappa B signaling pathway
uah04115  p53 signaling pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04621  NOD-like receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah05012  Parkinson disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05145  Toxoplasmosis
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05212  Pancreatic cancer
uah05220  Chronic myeloid leukemia
uah05222  Small cell lung cancer
uah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113258461 (BCL2L1)
   04630 Jak-STAT signaling pathway
    113258461 (BCL2L1)
   04064 NF-kappa B signaling pathway
    113258461 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    113258461 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113258461 (BCL2L1)
   04137 Mitophagy - animal
    113258461 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    113258461 (BCL2L1)
   04215 Apoptosis - multiple species
    113258461 (BCL2L1)
   04115 p53 signaling pathway
    113258461 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113258461 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113258461 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    113258461 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113258461 (BCL2L1)
   05225 Hepatocellular carcinoma
    113258461 (BCL2L1)
   05220 Chronic myeloid leukemia
    113258461 (BCL2L1)
   05222 Small cell lung cancer
    113258461 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    113258461 (BCL2L1)
   05014 Amyotrophic lateral sclerosis (ALS)
    113258461 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113258461 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    113258461 (BCL2L1)
   05162 Measles
    113258461 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    113258461 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113258461 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113258461 (BCL2L1)
   01524 Platinum drug resistance
    113258461 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113258461 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:uah03036]
    113258461 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:uah02000]
    113258461 (BCL2L1)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113258461 (BCL2L1)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    113258461 (BCL2L1)
Transporters [BR:uah02000]
 Other transporters
  Pores ion channels [TC:1]
   113258461 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 113258461
NCBI-ProteinID: XP_026359024
UniProt: A0A3Q7WXN8
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaagga
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaagcaagcgctgagggaggccggggatgagttcgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg
gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system