KEGG   Ursus arctos horribilis: 113258609
Entry
113258609         CDS       T05909                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04064  NF-kappa B signaling pathway
uah04066  HIF-1 signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04072  Phospholipase D signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04750  Inflammatory mediator regulation of TRP channels
uah04919  Thyroid hormone signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05012  Parkinson disease
uah05135  Yersinia infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
uah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113258609 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113258609 (PLCG1)
   04015 Rap1 signaling pathway
    113258609 (PLCG1)
   04012 ErbB signaling pathway
    113258609 (PLCG1)
   04370 VEGF signaling pathway
    113258609 (PLCG1)
   04064 NF-kappa B signaling pathway
    113258609 (PLCG1)
   04066 HIF-1 signaling pathway
    113258609 (PLCG1)
   04020 Calcium signaling pathway
    113258609 (PLCG1)
   04070 Phosphatidylinositol signaling system
    113258609 (PLCG1)
   04072 Phospholipase D signaling pathway
    113258609 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113258609 (PLCG1)
   04660 T cell receptor signaling pathway
    113258609 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    113258609 (PLCG1)
   04659 Th17 cell differentiation
    113258609 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    113258609 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    113258609 (PLCG1)
   04670 Leukocyte transendothelial migration
    113258609 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    113258609 (PLCG1)
   04919 Thyroid hormone signaling pathway
    113258609 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113258609 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113258609 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    113258609 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113258609 (PLCG1)
   05206 MicroRNAs in cancer
    113258609 (PLCG1)
   05205 Proteoglycans in cancer
    113258609 (PLCG1)
   05231 Choline metabolism in cancer
    113258609 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113258609 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113258609 (PLCG1)
   05214 Glioma
    113258609 (PLCG1)
   05223 Non-small cell lung cancer
    113258609 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    113258609 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113258609 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113258609 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113258609 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113258609 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113258609 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113258609 (PLCG1)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     113258609 (PLCG1)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    113258609 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    113258609 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 113258609
NCBI-ProteinID: XP_026359292
UniProt: A0A3Q7X9R2
LinkDB
Position
Unknown
AA seq 1290 aa
MAGAASPCANGCAPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIRGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFSLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPASLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNSRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLVKIDVFPAKQENGDLSPFSMSLRERGSDTSGQLFHGRAREGSFEARYQQPFEDF
RISQEQLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgcgcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccggagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgcgaaatcaaggag
atccgcccagggaagacctcacgggattttgatcgctaccaagaggaccctgctttccga
ccagaccagtcacactgctttgtcatcctgtatgggatggaattccgcctgaagaccctg
agcctgcaagctacgtctgaggatgaagtaaacatgtggatcaggggtttaacctggttg
atggaggatacattgcaggcagccacgcctctgcagatcgagaggtggctgcggaagcag
ttctactcggtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcgtctgacggac
ctggagcagcgcagcagtgacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtgccctgagggct
ggggagcggccagagctctgtcgtgtgtcccttcctgagttccagcagttcctcctcgag
taccagggggagctgtgggctgttgaccggcttcaggtgcaggagttcatgctcagcttc
cttcgagaccccttgcgagaaattgaagagccatacttctccctggatgagtttgtcacc
ttcctgttctcgaaagagaacagtgtgtggaactcgcagctggatgcagtgtgcccagat
accatgaacaatcctctctcccactactggatctcttcctcccacaacacgtacctgacc
ggggaccagttctccagcgagtcctccctagaagcctacgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccagatgggatgccagtcatttaccat
ggacacacccttaccaccaagatcaagttctcggacgttctgcacaccatcaaggagcat
gccttcgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgct
cagcagagaaatatggcacagtatttcaagaaggtgcttggggacacactccttaccaag
cccgtggacatcgctgccgacgggctcccctcgcccaaccagctcaagaggaagatcctc
atcaagcacaagaagctggcggagggcagcgcctacgaagaggtgcctacgtcggtgatg
tactccgagaatgatatcagcaactccatcaagaatggcatcctctacctggaggacccc
gtgaaccatgaatggtacccccactacttcgttctgaccagcagcaagatctactactct
gaggagaccagcagcgaccagggcaatgaggatgaggaggagcccaaggaggccagtggc
agcacagagctgcactccagtgagaagtggttccatgggaagctcggggcgggacgggac
ggacggcacatcgctgagcgcctgctcaccgagtactgcatcgagaccggggcccctgat
ggctccttcctcgtgcgggagagcgagaccttcgtgggcgactacaccctctctttctgg
aggaacggaaaagtccagcactgccggatccactcccggcaggacgctggggcccccaag
ttcttcttgacagacaacttggtctttgactcactctatgacctcatcacgcactaccag
caggtgcccctgcgctgcaacgaatttgagatgcgcctctcagagcctgtcccgcagacc
aatgcccacgagagcaaagagtggtaccacgccagcctgaccagagctcaggctgaacac
atgctgatgcgtgtcccccgggatggggccttcctggtgagaaaacggaatgagcccaac
tcctacgccatctccttccgggccgagggcaagatcaagcattgccgcgtccagcaggag
ggccagacggtgatgctgggcaactcggagtttgacagcctcgtggacctcatcagctac
tatgagaagcacccgctgtaccgcaagatgaagctgcgctaccccatcaacgaggaggcg
ctagagaagatcggcaccgctgagcctgactatggagccttgtatgagggacgcaaccct
ggcttctacgtggaggcaaatcctatgccgactttcaagtgtgcggtcaaagccctcttt
gactacaaggcccagagggaggacgagctgacgttcacaaagagcgccatcatccagaac
gtggagaagcaagaaggcggctggtggcggggggactacggggggaagaagcagctgtgg
ttcccgtcaaactacgtggaggagatggtcagccctgcatccctggagccggagagggag
cacttggacgagaacagccccctgggggacttgctccggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacagccggctcttcgtcttctccatcagc
atggcttcagtggcgcactggtccttggacgtcgctgctgactcacaggaggagctgcag
gactgggtgaagaagatccgagaagtggcccagacggcagatgccaggctcacggagggg
aagatgatggagcgcaggaagaagattgccctggagctctccgagctggttgtctactgt
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcctgctaccgggacatg
tcgtcctttccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccgcctgcagctctcccgcatctaccccaagggccagcggctagactcc
tccaattacgaccccttgcccatgtggatctgcggcagtcagctggtggccctcaacttc
cagacgccagacaagcctatgcagatgaaccaggcgctcttcatggccggcggccactgc
ggctacgtgctgcagcccagcaccatgcgggatgaggcctttgacccctttgacaagagc
agcctccgaggcctagagccatatgccatctgcattgaggtgctgggggcccggcacctg
ccaaagaatggccgaggcatcgtgtgtccttttgtggagattgaggtggccggagcggaa
tatgacagcatcaagcagaagacagagtttgtggtggacaatggactgaaccctgtgtgg
cctgccaagcccttccacttccagatcagtaacccggaattcgcctttttgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctaccttcccggtg
aaaggcctgaagacaggatacagagccgtgcctttgaagaacaactacagtgaggacttg
gagctggcctccctgctcgtcaagatcgatgttttccctgccaagcaggagaacggggac
ctcagtcccttcagtatgtctctgcgggagcggggctccgatacctcaggccagctgttt
catggccgggcccgggaaggttcctttgaagcccgctaccagcagccatttgaggacttt
cgtatctcccaggagcagctggcagaccattttgacagtcgggaacggagggccccacga
aggactcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system