KEGG   Ursus arctos horribilis: 113258674
Entry
113258674         CDS       T05909                                 

Gene name
CD40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04064  NF-kappa B signaling pathway
uah04514  Cell adhesion molecules (CAMs)
uah04620  Toll-like receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah05144  Malaria
uah05145  Toxoplasmosis
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05202  Transcriptional misregulation in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05322  Systemic lupus erythematosus
uah05330  Allograft rejection
uah05340  Primary immunodeficiency
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113258674 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113258674 (CD40)
   04514 Cell adhesion molecules (CAMs)
    113258674 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113258674 (CD40)
   04672 Intestinal immune network for IgA production
    113258674 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113258674 (CD40)
  09163 Immune disease
   05310 Asthma
    113258674 (CD40)
   05322 Systemic lupus erythematosus
    113258674 (CD40)
   05320 Autoimmune thyroid disease
    113258674 (CD40)
   05330 Allograft rejection
    113258674 (CD40)
   05340 Primary immunodeficiency
    113258674 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113258674 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113258674 (CD40)
   05169 Epstein-Barr virus infection
    113258674 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    113258674 (CD40)
   05145 Toxoplasmosis
    113258674 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113258674 (CD40)
   04090 CD molecules [BR:uah04090]
    113258674 (CD40)
Cytokine receptors [BR:uah04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113258674 (CD40)
CD molecules [BR:uah04090]
 Proteins
  113258674 (CD40)
SSDB
Motif
Pfam: TNFR_c6 RANK_CRD_2
Other DBs
NCBI-GeneID: 113258674
NCBI-ProteinID: XP_026359425
UniProt: A0A3Q7W371
LinkDB
Position
Unknown
AA seq 313 aa
MVLLPLRCLFWGSLLTAVHPERIVCREKQYLINSQCCNLCPPGEKLVNDCTEITDTECIR
CKEGEFLGTWNTERHCHQHKYCDPNLGLRVQREGTSETDTICTCDKGLHCTNDACESCTL
HSLCLPGLGVRQIATGVSDTVCDPCPVGFFSNVSSALEKCHPWTSCETKGLMEIEAGTNK
TDAVCGSPPRIRALVVIPITMGILLAVLLVSACISECPGKVAKEPENKVGQPRGPAQGFG
KLERKPDSLLTVWQENRFKVYPCGGREGSRSSSSHPQCWAAGRALPVHSLAPPTSVLSGT
PSPQSSPGILGKI
NT seq 942 nt   +upstreamnt  +downstreamnt
atggttcttctgcctctgcgctgtctcttctggggctccttgttgaccgccgtccaccca
gaacgcattgtatgcagagaaaagcaatacctaataaacagtcagtgctgtaatttgtgt
cctccaggagagaaactggtgaatgactgcacagagatcaccgacacagaatgcattcgt
tgcaaagaaggcgaattcctaggcacttggaacacagagagacactgtcaccagcacaaa
tactgcgaccccaacctagggctccgggtccagagggagggcacctcagaaacagacacc
atttgcacatgtgataaaggtctccactgtaccaacgatgcctgtgaaagctgcaccctg
cacagcctgtgcctccctggcctgggagtcaggcagattgctacaggggtctctgatacg
gtctgtgatccctgccccgtcggcttcttctccaatgtgtcatctgctttggaaaagtgt
cacccttggacaagctgcgagaccaaaggcctgatggagattgaggcggggactaacaag
acggatgccgtctgtggttccccacctcggataagagccttggtggtgatccccatcacg
atggggatcctgcttgctgtcctgttggtgtctgcctgtatcagtgagtgcccaggaaag
gtggccaaggagccagagaataaggtaggtcagccccggggaccggctcagggttttggc
aaactggagagaaagcctgactcactgttgactgtctggcaggaaaaccgattcaaggtc
tacccctgtggtgggcgggaaggcagcagaagcagctcctctcacccccagtgctgggct
gcggggagggctcttcccgttcactccctggcaccacccacctctgtcctctcagggacc
ccctccccgcagagcagccctggcatccttggcaagatctga

DBGET integrated database retrieval system