KEGG   Ursus arctos horribilis: 113258968Help
Entry
113258968         CDS       T05909                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04115  p53 signaling pathway
uah04210  Apoptosis
uah04217  Necroptosis
uah04650  Natural killer cell mediated cytotoxicity
uah04668  TNF signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04940  Type I diabetes mellitus
uah05010  Alzheimer disease
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113258968 (FAS)
   04668 TNF signaling pathway
    113258968 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113258968 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113258968 (FAS)
   04217 Necroptosis
    113258968 (FAS)
   04115 p53 signaling pathway
    113258968 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113258968 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113258968 (FAS)
   05205 Proteoglycans in cancer
    113258968 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113258968 (FAS)
   05330 Allograft rejection
    113258968 (FAS)
   05332 Graft-versus-host disease
    113258968 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113258968 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113258968 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113258968 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113258968 (FAS)
   05162 Measles
    113258968 (FAS)
   05164 Influenza A
    113258968 (FAS)
   05161 Hepatitis B
    113258968 (FAS)
   05160 Hepatitis C
    113258968 (FAS)
   05168 Herpes simplex virus 1 infection
    113258968 (FAS)
   05163 Human cytomegalovirus infection
    113258968 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113258968 (FAS)
   05169 Epstein-Barr virus infection
    113258968 (FAS)
   05165 Human papillomavirus infection
    113258968 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113258968 (FAS)
   05143 African trypanosomiasis
    113258968 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113258968 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113258968 (FAS)
   04090 CD molecules [BR:uah04090]
    113258968 (FAS)
Cytokine receptors [BR:uah04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113258968 (FAS)
CD molecules [BR:uah04090]
 Proteins
  113258968 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6 CcmH SIT BatD ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 113258968
NCBI-ProteinID: XP_026359870
UniProt: A0A3Q7W4H6
LinkDB All DBs
Position
Unknown
AA seq 319 aa AA seqDB search
MGPNYLALSSSAVVQILTSIARPWPKGVDAQATAVSSKLLRVRKNITIRETGCPEGLHRG
NTFCCQPCPPGTRKEGDCKSERGESICVLCQEGVEYTEEKHFSDKCRRCILCDGEHGLEV
EKNCTRTQNTKCRCKPNFFCNVSECGHCTPCTTCEHGILESCTPTSNTKCKEGSSSKFLW
FCVLIPILVAALICWWMLRRRRKKSNEVLRSTGSTTEMMPINFADIDLSKYITSVSEQMT
ITQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKDAYCNLIRGLRKA
NFCALAERIEEMIQRDITS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctaactacttagctttgtcctcctctgcagtggtacagatacttacctccatc
gccagaccatggcctaaaggtgtcgacgctcaagcaacggctgtcagctccaagctgttg
agagtgcggaagaacattactataagggagacggggtgcccggaaggtctgcatcgtggg
aacacgttctgctgtcagccatgtcctcctggcacgcggaaagagggcgactgcaagtct
gagaggggtgaatcaatatgtgtgctctgccaggaaggggtggagtacacagaggagaag
catttttctgataaatgcagaagatgcatactttgtgatggagagcacggcttggaagtg
gaaaaaaactgtacccggacccagaataccaagtgcaggtgtaaaccaaactttttttgt
aacgtctctgaatgcggacactgtaccccgtgcaccacgtgtgaacacggaatccttgag
agctgcacaccaaccagcaacaccaaatgcaaagaaggatccagctccaaatttctgtgg
ttttgtgtcctaatcccgattctagtagctgcactaatatgttggtggatgttaagacgg
cgcaggaagaaaagcaatgaagtccttcgatccacaggctcaaccactgaaatgatgcca
ataaattttgcagacatcgacctgagtaaatatatcactagtgtttctgaacaaatgaca
ataactcaagtcagagaatttgttcggaagaatggtatcaacgaagccaagatagatgag
atcaagaatgacaatctccaagacacagcggaacagaaagtccagttgctccgtaattgg
taccaactccacgggaggaaagatgcatattgcaatttaattagaggcctcagaaaagcc
aatttctgtgcactagcagagagaattgaagaaatgatccagagagacattactagctaa

DBGET integrated database retrieval system