KEGG   Ursus arctos horribilis: 113259128Help
Entry
113259128         CDS       T05909                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah00010  Glycolysis / Gluconeogenesis
uah00051  Fructose and mannose metabolism
uah00052  Galactose metabolism
uah00500  Starch and sucrose metabolism
uah00520  Amino sugar and nucleotide sugar metabolism
uah00524  Neomycin, kanamycin and gentamicin biosynthesis
uah01100  Metabolic pathways
uah01200  Carbon metabolism
uah04066  HIF-1 signaling pathway
uah04910  Insulin signaling pathway
uah04930  Type II diabetes mellitus
uah04973  Carbohydrate digestion and absorption
uah05230  Central carbon metabolism in cancer
Module
uah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
uah_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113259128 (HK1)
   00051 Fructose and mannose metabolism
    113259128 (HK1)
   00052 Galactose metabolism
    113259128 (HK1)
   00500 Starch and sucrose metabolism
    113259128 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    113259128 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    113259128 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    113259128 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113259128 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113259128 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    113259128 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113259128 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113259128 (HK1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     113259128 (HK1)
Membrane trafficking [BR:uah04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    113259128 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 113259128
NCBI-ProteinID: XP_026360146
UniProt: A0A3Q7VGF0
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEGILITWTKKFKASGV
EGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKESLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFRLT
KDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNDGRMCINMEWGAFGDNGCLDD
IRTLYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLREETSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaaccctgatagatatcatg
actcgtttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgagggtacaagtgaatcacgag
caaaaccagaatgttcacatggagtccgagatttatgacaccccggagaacatcgtgcat
ggcagtggaagccagctttttgatcacgtggccgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccctgtcggcag
tccaaaatagacgagggcatcctgataacctggacaaagaaatttaaagcgagcggagtg
gagggaatggatgtggtgaagttgcttaacaaagccattaagaagcgcggggactacgac
gccaacattgtggccgtggtgaacgacacggtggggaccatgatgacctgtggctacgat
gaccagcagtgtgaagtcggcctcatcatcggcaccggcaccaacgcctgctacatggag
gagctgaggcacattgacctggtggagggcgatgaggggaggatgtgcgtcaacacggag
tggggggccttcggcgacgacgggtccctggaagacatccgcaccgagttcgaccgggag
atagaccgtggctctctcaaccccgggaagcagctgtttgagaagatggtcagtggcatg
tacttgggggagctggtgcgactgatcctggtcaagatggccaaggagagcctcttgttt
gaagggcggatcaccccggagctgctcaccagggggaagttcaagaccagcgacgtgtca
gccattgagaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccatccgatgacgactgtatttcagtccagcacgtgtgtaccattgtctcattt
cgctcggccaacctggtggctgcaacgctgggcgccatcttgaaccgccttcgagataac
aagggcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgcccgactccgatgtg
cgcttcctcctctcggagagcggcagtggcaagggggcggccatggtcacggcggtggcc
taccgcctggcggagcagcaccggcagatagaggagaccctggcccacttccgcctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggatatgggcctgagg
aagcagacacacgagaaggccgtggtcaagatgctgccctcctttgtccggagcactcca
gacgggaccgagcatggtgacttcttggcccttgatcttggaggaacaaatttccgtgtc
ctgctggtgaaaatccgcagtgggaaaaagagaacggtggaaatgcacaacaagatctat
gccattcccattgaaatcatgcagggcactggggaagagctgtttgaccacatcgtctcc
tgcatctctgacttcctggactacatggggatcaaaggccccaaaatgcctctgggcttc
acgttctccttcccctgcaagcagacgagcctggatgcgggaatcttgatcacctggacc
aagggttttaaggcaaccgactgcgtggggcacgacgtagcaaccttactaagggaagcg
ataaaacggagagaggaattcgacctggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttacgaggagcctacctgcgaggttggactcattgtagggacc
ggcagcaacgcctgctacatggaggaaatgaagaatgtcgagacgctggaggggaatgac
gggcgcatgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctagatgat
atcagaacactctatgacagactggtggatgaatattctctaaacgctgggaaacaaagg
tacgagaagatgattagcggtatgtacctgggtgagatcgtccgcaacatcttgatcgac
ttcaccaagaagggcttcctcttccgagggcagatctctgagacgctgaagacccggggc
atctttcagaccaaatacctttcccagattgagagtgaccgattagcgctgctccaggtc
cgggccatcctccagcagctgggcctgaacagcacctgtgacgacagtatcctggtcaag
actgtgtgcggggtggtgtccaagagggccgcgcagctgtgtggtgcgggcatggctgcc
gtggtggataagatccgagagaacagagggctggaccacctcaacgtgactgtgggggtg
gacggaacactctacaagcttcatccgcacttctccagaatcatgtaccaaaccgtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctgtccgaagacggtagcggcaagggg
gccgccctcatcacggcggtgggcgtccggctccgggaagagacgagcagctaa

DBGET integrated database retrieval system