KEGG   Ursus arctos horribilis: 113259145Help
Entry
113259145         CDS       T05909                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1
  KO
K07818  perforin 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04210  Apoptosis
uah04650  Natural killer cell mediated cytotoxicity
uah04940  Type I diabetes mellitus
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113259145 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113259145 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113259145 (PRF1)
   05330 Allograft rejection
    113259145 (PRF1)
   05332 Graft-versus-host disease
    113259145 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113259145 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113259145 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2
Motif
Other DBs
NCBI-GeneID: 113259145
NCBI-ProteinID: XP_026360186
UniProt: A0A3Q7VGI7
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MGARLFLPGLLLLLLPTPTPAPCRTATRNECRNNRVFVPGVALAGEGVDVTTLRRSGSFP
VDTESFLRPDGTCTLCQNALQEDALQRLPLALTGWRAQGSGCQRQVVRAKASSTDGVARE
AASNIRNDWRVGLDVSPKPSVNVQVTVAGSHSEMANFAAHKSHRDQYRFTTDLVVCRFYS
FHLVHSPPLHPNFQRALSDLPPSFNTSTEADYLRLISSYGTHFIRSVELGGRISVLTALR
TCELALDGLTANEVEDCLAVEAQVSISGRASSSSEFKACEEKKKQHKMETSFHQSYQERF
SQIVGGHHTSVGDLLFGTQAGPEQFSAWMNSLLDRPGLVDYTLEPLHVLVESQDPRREAL
RQAVSKYVMDRARWKDCSRPCPPGQRKSPHNPCQCVCHSSATTNQDCCPRQRGLARLEVM
NFQAAGLWGDHFTATDAYLKVFFGGQELRTNTVWNNNHPKWMTRLDFGDVLLSTGGPLRV
QVWDQDNGWDDDLLGTCDQKAQTGSHEVRCHLNHGHLRFSYQAKCLPHLEGPTCLQYAPH
GLLGAPPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccgcctgttcctcccgggcctcctcctcctattgctgcccacgcccaccccg
gcaccctgccgcacggccacccgcaatgagtgccggaacaaccgcgtgttcgtacctggc
gtggcgctggccggggagggtgtggacgtgaccacgctcaggcgctcgggctccttccca
gtggacacagagagcttcctgcgccccgacggcacctgcaccctctgccagaatgccctg
caggaggacgccctccagcgcctgcccctggcactgaccggctggcgcgcccagggctca
ggctgccagcgccaagtggtcagggccaaggccagctccaccgacggcgtggccagggag
gcggccagcaacattcgcaacgactggcgggtggggctggatgtgtctcccaaacccagc
gtcaatgtgcaggtgaccgtggccggctcgcactccgagatggccaacttcgctgcccac
aagagccaccgggaccagtataggttcaccactgacttggtggtatgtcgcttctacagt
tttcacctggtacactctcccccactccaccccaacttccagagggccctcagcgacctg
ccccccagcttcaacacctccacagaggctgactacctcaggctcatctccagctacggc
acccacttcatccggtccgtggagctgggcggccggatctcggtgctcactgccctgcgc
acctgtgagctggccctggacgggctcacggccaacgaggtggaggactgcctggccgtc
gaggcccaggtcagcataagtggccgcgccagctcgtcatcagaattcaaggcctgtgag
gagaagaagaagcagcacaagatggagacctccttccaccagtcctaccaggaacgcttt
tcccaaatagtcgggggccaccacacctccgtgggcgacctactgtttgggacccaggcc
gggccggagcagttctcagcctggatgaactcactgctggacagacccggcctggtggac
tataccctggaacccctgcacgtgctcgtggagagccaggacccccggcgggaggcgctc
aggcaggccgtgagcaagtacgtgatggaccgggcccgctggaaggactgcagcaggccc
tgccccccgggacagcggaagagcccccacaacccatgccagtgcgtgtgccacagctcg
gcgaccaccaaccaggactgctgcccccggcagaggggcctggcccgcttggaggttatg
aacttccaggcggcaggcctgtggggagatcacttcaccgccacagacgcctatctgaaa
gtcttcttcggaggccaggagctgagaaccaacacggtgtggaacaacaaccaccccaag
tggatgacgcggctggacttcggggacgtgctcctgtccacgggggggcccctgagggtg
caggtctgggaccaagacaatggctgggacgacgacctcctcggcacctgtgaccagaaa
gcacagactggctcccatgaggtgagatgccacctgaaccacggtcacctgagattctcc
taccaggccaagtgcttgcctcacctggaggggcctacctgcctgcagtatgccccccac
ggtcttctgggggctcctccaggaaaccggagcgggccggtgtggtga

DBGET integrated database retrieval system