KEGG   Ursus arctos horribilis: 113259485
Entry
113259485         CDS       T05909                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05164  Influenza A
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113259485 (IFNGR1)
   04066 HIF-1 signaling pathway
    113259485 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113259485 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113259485 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113259485 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    113259485 (IFNGR1)
   04659 Th17 cell differentiation
    113259485 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113259485 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113259485 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113259485 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113259485 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113259485 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    113259485 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    113259485 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113259485 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113259485 (IFNGR1)
   05140 Leishmaniasis
    113259485 (IFNGR1)
   05142 Chagas disease (American trypanosomiasis)
    113259485 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113259485 (IFNGR1)
   04090 CD molecules [BR:uah04090]
    113259485 (IFNGR1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IFN receptor family
   113259485 (IFNGR1)
CD molecules [BR:uah04090]
 Proteins
  113259485 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 113259485
NCBI-ProteinID: XP_026360671
UniProt: A0A3Q7VHY3
LinkDB
Position
Unknown
AA seq 509 aa
MPGLPLERWSPGPEVTRRSGCGLNARILSRPHPESALSGMALQLLLVLVLQAGSWAEMSP
ADLELSSVPVPTNIRFEAHNFNTVLRWDYPTMPQTPVFTVQVKNYGEAIWIDACNTSHHN
CDIFSVINDPSLSLWARIKARLGQKESAYVESKEFILCKQGNIGPPAVGIRKMENQIIID
IFHPLTNISGREPVPIYDENNCHIFIYTVNLRINGSETIYKTTVENEDDCNETQCHLVIP
LSSLNSDYCISVDGVSKDWPVTTEMSKELCITTSDDRHMEDSVWIPIVAALLFLVLMLVF
VFCYTKKMNPCKRESIMLPKSLLSVVKNASSETKSESKCISPITYQPIVPENEKMVWEEQ
LSPATVAGTPTEDNLGKMEHREDVSSEIEVVTIEENTSDMAPGSPPTPGMRENSVHSNSN
QSEPCVVAFNSYHSRNGSDSGVVESDGFLSDSEFPPNNKTEQKPEVQECVVLRNTITSFG
YDKPHVLVELPVDEGGKESLIGYRLTADS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcccggcctccccttggagcgctggtcccctggtccggaagtgacgcgacgctcgggc
tgcgggctcaacgcccgcattctctcaaggccgcaccccgagtcagccctgagcggcatg
gctctgcaacttctgctcgtcctcgtcttgcaggccgggagctgggctgagatgagcccc
gcggatctggagctgtcttcggtgcctgtaccaaccaatattagatttgaggcccataat
tttaatactgtcctacgctgggactacccaaccatgccacagacccctgtttttactgta
caggtaaagaactatggggaagcaatatggattgatgcctgcaatacctctcatcataat
tgtgatatcttttccgtaattaatgatccgtcactttctctctgggccagaattaaagct
aggcttggacaaaaagaatcagcctatgtagagtccaaagaatttattttatgtaaacaa
gggaacattggaccacctgcagtaggtatcagaaagatggaaaaccaaatcatcattgac
atatttcaccctttaactaatataagtggaagagagccagtacccatatatgacgaaaat
aattgtcacatattcatatacacggtgaatttgagaataaatggaagtgagaccatctat
aaaacgacagtagagaatgaagatgattgcaatgagacccagtgccaccttgttatcccg
ctgtcctccctgaactctgactactgtatttcagtagatggcgtctcaaaagattggccc
gttacgaccgagatgtccaaagaactttgtattaccacttctgatgatcgccacatggaa
gattctgtttggattccgattgttgctgctctcctgtttctagtgcttatgctggtattt
gtattttgttacactaagaagatgaatccatgtaagagagaaagcatcatgttacccaag
tccttgctgtctgtggtaaaaaatgcctcctcagagacaaaatcggaatccaagtgtata
tcacccatcacctaccaaccgattgtcccagaaaatgagaagatggtctgggaagagcag
ttgtctccagcaacagttgcagggacacccactgaagacaacctaggaaaaatggaacac
cgagaagacgtttccagtgaaatagaagtggtgaccattgaagaaaatacttctgacatg
gctcctggtagccctccgaccccaggaatgagagagaattctgtccattcaaatagtaac
cagtctgaaccctgtgtcgtcgccttcaactcctatcactccagaaatggttctgacagt
ggcgttgtggaatctgatggcttcttatctgactcagaatttcccccaaataacaaaact
gaacagaagcctgaagtccaggagtgcgtagtgctgagaaacaccatcacctcctttggt
tacgacaagccgcacgtgttagtggagctgcctgtggatgaaggtggcaaggaatccttg
attggttatagactgacggcagattcctga

KEGG   Ursus arctos horribilis: 113264675
Entry
113264675         CDS       T05909                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264675 (IFNGR2)
   04066 HIF-1 signaling pathway
    113264675 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113264675 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113264675 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113264675 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    113264675 (IFNGR2)
   04659 Th17 cell differentiation
    113264675 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113264675 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113264675 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113264675 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113264675 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113264675 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    113264675 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    113264675 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113264675 (IFNGR2)
   05140 Leishmaniasis
    113264675 (IFNGR2)
   05142 Chagas disease (American trypanosomiasis)
    113264675 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113264675 (IFNGR2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IFN receptor family
   113264675 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 113264675
NCBI-ProteinID: XP_026367397
UniProt: A0A3Q7XVZ3
LinkDB
Position
Unknown
AA seq 353 aa
MRPPPPPLSLLSLLLLLLLGGRGAPALPADSRFQLPAPRNPKIRLYNNEQVLRWEPGSLS
NDTRPVVYQVQFTFLSGSRWYDTDDIGVNCMNVTKTECNFTPSSLSEGLPLFFNVSLRVR
AKAQDLVSPWLTVPWFLYYWNVTVGPPENVWVTPGEGSLIVRFSSPFDIPASKATFQYYV
HYWEKAGIQKVEGPFRSNSIVLNGLKPLREYCLQVRAHLIWTHYNISRPGHLSNVSCYET
TMDATTRLQQVIVIAVGIFLLLSALAGACFFLVLRYKGLVKYWFHSPPSIPSQIEEYLKD
PSQPILEALDKDTSPTDDAWDSVSVISFAEKDREAAPQSTLNPNSGPVCQPVG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcggcccccgccgccgccgctgtcgctgctgtcgctgctgctgctgctgctgctcggc
ggccgcggcgcccccgcgctcccggcagactctcgcttccagctgccagctcctcgaaac
ccgaagattcgcctgtacaacaacgagcaggttctgaggtgggagccggggtccctgagc
aatgacacaaggccggtggtctaccaggtgcagttcacattcctctctggcagtaggtgg
tacgacaccgacgacataggtgtgaactgtatgaacgtcaccaagacagagtgtaacttc
accccatccagcctctcagagggtttgccactgtttttcaacgtctctttacgcgtccga
gctaaggcgcaggacctggtttccccctggctgacggtgccttggttcctgtactattgg
aatgtgaccgttggacctcctgagaacgtctgggtgaccccaggagaaggttccctgatc
gtcaggttctcctctcccttcgacatccctgcctccaaggccacttttcagtattacgtc
cattactgggaaaaggcaggaatccaaaaggttgaaggtcctttcaggagcaactccatc
gtgttgaatggcttgaaacccttgagagaatactgtttacaagtgagggcacatctgatt
tggacgcactacaacatctcgaggcccggacatttaagcaacgtatcttgctacgaaaca
acaatggatgccactaccaggctgcaacaagtcatcgtgattgccgtgggcatctttctg
ttgctgtcggcgctggcgggggcctgtttctttctggtcctgagatacaaaggcctggta
aaatactggtttcactctccgccgagcatcccgtcacaaatcgaagagtatttaaaggac
ccgagccagcctatcttagaggccctggacaaggacacgtcaccaacggatgatgcctgg
gactctgtgtccgtcatttcgtttgcagagaaggatcgagaagctgctccccaaagcact
ttgaacccaaactctggtccggtctgccagcctgtgggatga

DBGET integrated database retrieval system