KEGG   Ursus arctos horribilis: 113259652
Entry
113259652         CDS       T05909                                 

Gene name
CCR6
Definition
(RefSeq) C-C chemokine receptor type 6
  KO
K04181  C-C chemokine receptor type 6
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113259652 (CCR6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113259652 (CCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113259652 (CCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113259652 (CCR6)
   04050 Cytokine receptors [BR:uah04050]
    113259652 (CCR6)
   04090 CD molecules [BR:uah04090]
    113259652 (CCR6)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113259652 (CCR6)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113259652 (CCR6)
CD molecules [BR:uah04090]
 Proteins
  113259652 (CCR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 113259652
NCBI-ProteinID: XP_026360987
UniProt: A0A3Q7WHB8
LinkDB
Position
Unknown
AA seq 375 aa
MSGEAMNFSTVFNFNEDYFGSGNTSDYSFDDDTLLCSLQEVRKFSGLFVPMAYSLICVFG
LLGNILVVVTFAFYKKAKSMTDVYLLNMAIADILFVLTLPFWAVSHATGKWIFSNAMCKL
MKGIYAINFNCGMLLLACISMDRYIAIVQATKSFRLRSRTLAHRRVICVVVWAASVLISG
WTFVFNQKYRVQGSDVCEPRYHEGSDPIKWKLLMLGLQLLFGFFIPLVFMVFCYMFIVKT
LVQAQNSKRHKAIRVVVAVVLVFLACQVPHNMVLLVTAAQMGRMNRSCHGQKVLGYSTSV
TEVLAFLHCCLNPVLYAFIGQKFRSYFLKIVKDLWCVRRRQKAPGFSCSRLHSETFISRQ
NSETVDNENASSFTM
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagtggggaagcaatgaatttcagcactgtcttcaacttcaatgaggattattttggg
tcgggtaatacttcggattattcatttgatgatgacaccttactgtgttccttgcaagag
gtcagaaaattttctgggctattcgtgcccatggcttactccctgatatgtgtctttggc
cttctgggcaacattttggtggtggtcacctttgctttttataagaaagccaagtccatg
acggacgtttatctcttgaatatggccatcgcagacatcctgtttgtcctcaccctcccg
ttctgggccgttagccacgctaccggcaagtggatcttcagcaatgccatgtgcaagctg
atgaagggcatctacgccatcaacttcaactgcgggatgctgctcctggcctgcatcagc
atggaccgctacatcgccatcgtgcaggccaccaagtcgttccggctgcgctccagaacg
ctggcgcaccgcagggtcatctgcgtggtggtgtgggcggcgtcggtgctcatctccggc
tggacctttgtgttcaaccagaagtacagggtgcagggcagcgacgtgtgcgagccccgc
taccacgagggctccgaccccatcaagtggaagctgctgatgttgggtctccagctcctc
tttggcttcttcatcccactggtgtttatggtcttctgctacatgttcatcgtcaaaacc
ctcgtgcaggctcagaactccaagcggcacaaggccatccgcgtggttgtcgcggtggtg
ctggtgttcctggcgtgccaggtgccccacaacatggtgcttctggtgacagccgcacag
atgggtaggatgaaccgctcctgccatggccagaaggtgctgggctacagcacgagcgtc
accgaggtcctggctttcctgcactgctgcctcaaccccgtgctctacgccttcatcggg
cagaagttcaggagctactttctgaagattgtgaaggacctgtggtgtgtgcgacggagg
cagaaggctccgggcttctcctgctcccggctgcactcggagaccttcatctccaggcag
aacagcgagactgtggacaacgagaacgcgtcgtccttcaccatgtga

DBGET integrated database retrieval system