KEGG   Ursus arctos horribilis: 113260003
Entry
113260003         CDS       T05909                                 

Gene name
CD3E
Definition
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
uah  Ursus arctos horribilis
Pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah05142  Chagas disease (American trypanosomiasis)
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113260003 (CD3E)
   04660 T cell receptor signaling pathway
    113260003 (CD3E)
   04658 Th1 and Th2 cell differentiation
    113260003 (CD3E)
   04659 Th17 cell differentiation
    113260003 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113260003 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    113260003 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113260003 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    113260003 (CD3E)
   05162 Measles
    113260003 (CD3E)
   05169 Epstein-Barr virus infection
    113260003 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113260003 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113260003 (CD3E)
CD molecules [BR:uah04090]
 Proteins
  113260003 (CD3E)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 Ig_3 ig DUF5816 DUF4986
Other DBs
NCBI-GeneID: 113260003
NCBI-ProteinID: XP_026361439
UniProt: A0A3Q7X4F8
LinkDB
Position
Unknown
AA seq 201 aa
MQSGKLWRILGLCLLSVGAWGQEEPEEPLGESTAPPLREGYKVSISGTRVLLTCPEEAED
ENLKWEKDNVLSDVQGKQLSLEPFSEMEDSGFYTCYADQSKEKNYLYLKARVCTNCMEVD
LIAVAAIIIADICVTLGLLLLVYYWSKNRKASAKPVMRATGAGGRTRGQNKEKPPPVPNP
DYEPIRKGQQDLYSGLNQRGI
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcagtccgggaaactctggagaattctgggactctgtctcttatcagttggcgcttgg
gggcaggaagagcctgaggaacctctgggcgaatcgacagctccccctctgagagaaggg
tataaagtctccatctctggaaccagggtactgctgacatgccctgaggaagctgaagat
gaaaatctaaaatgggaaaaagataatgttttatctgatgttcaggggaaacagctctct
ctggagcctttttcagaaatggaggacagtggtttttatacctgctatgcagaccagtca
aaggagaagaactatctctacctgaaagcaagagtgtgtacgaactgcatggaggtggat
ctgatagcagtggctgcaatcatcatagcggacatctgcgtcaccctgggcttgctgctg
ctggtgtattactggagcaagaacagaaaggccagtgccaagcctgtgatgagagcaacg
ggtgctggtggcaggactagaggacaaaacaaggagaagccaccacctgttcccaatcca
gactatgagcccatccggaaaggccagcaggacctgtattctggtctgaatcagagaggc
atctga

DBGET integrated database retrieval system