KEGG   Ursus arctos horribilis: 113260053
Entry
113260053         CDS       T05909                                 

Gene name
IL18
Definition
(RefSeq) interleukin-18
  KO
K05482  interleukin 18
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04621  NOD-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah05132  Salmonella infection
uah05134  Legionellosis
uah05135  Yersinia infection
uah05143  African trypanosomiasis
uah05144  Malaria
uah05152  Tuberculosis
uah05164  Influenza A
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260053 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260053 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113260053 (IL18)
   04623 Cytosolic DNA-sensing pathway
    113260053 (IL18)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113260053 (IL18)
   05321 Inflammatory bowel disease (IBD)
    113260053 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113260053 (IL18)
   05135 Yersinia infection
    113260053 (IL18)
   05134 Legionellosis
    113260053 (IL18)
   05152 Tuberculosis
    113260053 (IL18)
  09172 Infectious disease: viral
   05164 Influenza A
    113260053 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    113260053 (IL18)
   05143 African trypanosomiasis
    113260053 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260053 (IL18)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113260053 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 113260053
NCBI-ProteinID: XP_026361544
UniProt: A0A3Q7X4R0
LinkDB
Position
Unknown
AA seq 192 aa
MAANTEDNCINFVEMKLIDNTLYFIAENDDSLESDYFGKLEPKLSIIRNLNDQVLFVNQG
NQPVFEDMPDSDCTDNAPHTVFIIYMYKDSLTRGLAVTISVKCKKISTLSCKNKTISFKE
MCPPNSINDEGNDIIFFQRSVPGHDDKIQFESSLYQGYFLACQKEKDLFKLTLKKKDESG
DKSIMFTVQNKS
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgctaacacagaagacaattgcatcaactttgtggaaatgaaacttattgacaac
acactttactttatagctgaaaatgatgacagcctggaatcagattactttggcaagctt
gaacctaaactctcaatcatacgaaatttgaacgaccaagttctcttcgttaaccaggga
aatcaacccgtgtttgaggatatgcctgattctgactgtacagataacgcaccccatact
gtatttatcatatatatgtataaagacagcctcactagaggtctggcggtaaccatctct
gtgaagtgtaagaaaatatctactctctcctgtaagaacaaaactatttcctttaaggaa
atgtgtcctcccaatagtatcaatgatgaaggaaatgacatcatattctttcagagaagt
gttccaggacatgacgataagatacaatttgagtcttcattgtaccaaggatactttcta
gcttgtcaaaaagagaaagatcttttcaaactcactttgaaaaaaaaggatgaaagtggg
gataagtccattatgttcactgttcaaaacaaaagctag

DBGET integrated database retrieval system